Align glutamate N-acetyltransferase/amino-acid acetyltransferase; EC 2.3.1.35 2.3.1.1 (characterized)
to candidate WP_020173917.1 A3OQ_RS0103225 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
Query= CharProtDB::CH_000559 (406 letters) >NCBI__GCF_000385335.1:WP_020173917.1 Length = 410 Score = 264 bits (674), Expect = 4e-75 Identities = 162/401 (40%), Positives = 225/401 (56%), Gaps = 10/401 (2%) Query: 13 LPDIDGIALYTAQAGVKKPGHTDLTLIAVAAGSTVGAVFTTNRFCAAPVHIAKSHLFDED 72 +P I+G+ T AG++ TD+ L G+ V VFT ++ +APV ++ L Sbjct: 13 IPPIEGVRFATGAAGIRYKERTDVMLALFDKGTQVAGVFTKSKCPSAPVDWCRAKL-KGG 71 Query: 73 GVRALVINTGNANAGTGAQGRIDALAVCAAAARQIGCKPNQVMPFSTGVILEPLPADKII 132 R LV+N+GNANA TG G A AA+ G +++ STGVI EPL A K Sbjct: 72 KARTLVVNSGNANAFTGKTGAEAVKFTAALAAKATGAPASEIFLASTGVIGEPLDAGKFD 131 Query: 133 AALPKM----QPAFWNEAARAIMTTDTVPKAASREGKVGDQHTVRATGIAKGSGMIHPNM 188 L ++ P EAA+AIMTTDT PK A+ + ++G V G+AKG+GMI P+M Sbjct: 132 GVLDRLAEAASPEGMLEAAKAIMTTDTYPKVATAKAEIGGVE-VTIAGMAKGAGMIAPDM 190 Query: 189 ATMLGFIATDAKVSQPVLQLMTQEIADETFNTITVDGDTSTNDSFVIIATG---KNSQSE 245 ATML F+ TDA + LQ++ + +FN IT+D DTST+D+ ++ ATG K Sbjct: 191 ATMLAFLFTDAPIDAEALQVLLAKAVPGSFNAITIDSDTSTSDTLLLFATGAAKKRGAPR 250 Query: 246 IDNIADPRYAQLKELLCSLALELAQAIVRDGEGATKFITVRVENAKTCDEARQAAYAAAR 305 I +D R A K L + L LA IV+DGEGA KF+ + VE A + A++ A + A Sbjct: 251 ITEPSDRRLASFKTALQKVCLNLAHQIVKDGEGARKFVEIAVEGAASAGAAKKIALSIAN 310 Query: 306 SPLVKTAFFASDPNLGKRLAAIGYADVADLDTDLVEMYLDDILVAEHGGRAASYTEAQGQ 365 SPLVKTA D N G+ + AIG A + D + ++ +I VA G R Y EA+ Sbjct: 311 SPLVKTAIAGEDANWGRIVMAIGKAG-EKAERDKLAIWFGNIRVAHKGLRDPKYDEAEVS 369 Query: 366 AVMSKDEITVRIKLHRGQAAATVYTCDLSHGYVSINADYRS 406 A M EI +++ L G+ ATV+TCDL+ YV+IN DYRS Sbjct: 370 AKMRLPEIEIKVDLGLGRGKATVWTCDLTKEYVAINGDYRS 410 Lambda K H 0.317 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 15 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 410 Length adjustment: 31 Effective length of query: 375 Effective length of database: 379 Effective search space: 142125 Effective search space used: 142125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory