Align Shikimate kinase; Short=SK; EC 2.7.1.71 (characterized, see rationale)
to candidate WP_020174079.1 A3OQ_RS23935 3-dehydroquinate synthase
Query= uniprot:AROK_RHIME (192 letters) >NCBI__GCF_000385335.1:WP_020174079.1 Length = 588 Score = 168 bits (426), Expect = 2e-46 Identities = 81/165 (49%), Positives = 115/165 (69%) Query: 20 LGKRNLVFIGLMGAGKSAIGRLTAQALGVPFVDSDHEIERVSRMTVSDLFATYGEEEFRA 79 LG R +V +G+MG+GK++ GR AQ LG+ FVD+D IE+ + M++ D+FA +GE FR Sbjct: 28 LGGRPIVLVGMMGSGKTSTGRRLAQRLGLNFVDADVVIEQAAAMSIEDIFARHGEAYFRD 87 Query: 80 LEARVLKRLLRSGPRVVSTGGGAYINERSRRHIKKGGLTIWLNAELDVLWERVNKRDTRP 139 E RV+ RLL GPRV++TGGGA++N R I G++IWL A+ DVLW RV +R TRP Sbjct: 88 GEKRVMARLLGEGPRVLATGGGAFMNAEVRERIAAEGISIWLKADFDVLWRRVRRRTTRP 147 Query: 140 LLKTENPKQTLENLMRARYPIYAEADLTVLSRDVKKEAMVEEVLA 184 LL P+ TL L+ RYP+YA+AD+TV S + + +V+E++A Sbjct: 148 LLNNAEPEVTLRRLIEERYPVYAQADITVQSHEGSHDDVVDEMMA 192 Lambda K H 0.317 0.133 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 192 Length of database: 588 Length adjustment: 28 Effective length of query: 164 Effective length of database: 560 Effective search space: 91840 Effective search space used: 91840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory