Align O-acetylhomoserine aminocarboxypropyltransferase (EC 2.5.1.49) (characterized)
to candidate WP_020175871.1 A3OQ_RS0113185 aminotransferase class V-fold PLP-dependent enzyme
Query= BRENDA::P94890 (442 letters) >NCBI__GCF_000385335.1:WP_020175871.1 Length = 429 Score = 452 bits (1164), Expect = e-132 Identities = 229/424 (54%), Positives = 298/424 (70%), Gaps = 10/424 (2%) Query: 17 TIALHGGQEPDPTTTSRAVPLYQTTSYVFKDTDHAARLFGLQEFGNIYTRLMNPTTDVLE 76 T A+H G PDPTT +RA P+YQTTS+VF+D DHAA LFGLQ FGNIYTR+ NPT VLE Sbjct: 12 TQAVHAGARPDPTTGARATPIYQTTSFVFEDVDHAAALFGLQAFGNIYTRITNPTNAVLE 71 Query: 77 KRVAALEGGVAALATASGQSAEMLALLNIVEAGQEIVASSSLYGGTYNLLHYTFPKLGIK 136 +R+AALEGG A LA ASG +A++L ++E G EIVA++ LYGG+ N L++ F K G Sbjct: 72 ERIAALEGGTAGLAVASGHAAQLLVFHTLLEPGDEIVAATKLYGGSINQLNHAFKKFGWG 131 Query: 137 VHFVDQSDPENFRKASNDKTRAFYAETLGNPKLDTLDIAAVSKVAKEVGVPLVIDNTMPS 196 V + D D +F A KT+A + E++ NP DI A++ +A E +PLV+DNT+ + Sbjct: 132 VKWADPDDLPSFAAAITPKTKAIFIESIANPGGVVTDIEAIAAIAHEKHLPLVVDNTLAT 191 Query: 197 PYLVNPLKHGADIVVHSLTKFLGGHGTSIGGIIIDGGSFNW-GNGKFKNFTEPDPSYHGL 255 PYLV P +HGADI+VHS TKFLGGHG SIGG+I+DGG+F+W + ++ + + P P Y G+ Sbjct: 192 PYLVRPFEHGADIIVHSATKFLGGHGNSIGGLIVDGGTFDWMADQRYPSLSAPRPEYGGM 251 Query: 256 KFWEVFGKFEPFGGVNIAFILKARVQGLRDLGPAISPFNAWQILQGVETLPLRMERHSGN 315 EVFG N AF + ARV GLRDLGPA+SPFNA+ IL G+ETLPLRM+RHS N Sbjct: 252 VLGEVFG--------NFAFAIAARVLGLRDLGPALSPFNAFLILTGIETLPLRMQRHSEN 303 Query: 316 ALKVAEFLQKHPKIEWVNYPGLSTDKNYATAKKYHERGLFGAIVGFEIKGGVEKAKKFID 375 AL VAE L +H + WV+YPGLS D+ + AKKY G GA+ F +KGG + + Sbjct: 304 ALAVAEHLAQHNAVNWVSYPGLSGDRYHNLAKKYCPAGA-GAVFTFGLKGGYDSGIALVK 362 Query: 376 GLELFSLLANIGDAKSLAIHPASTTHQQLTGPEQISAGVTPGFVRLSVGLENIDDILVDL 435 L+LFS LAN+GD +SL IHPASTTH+QL ++I AG P VRLSVG+E+ D++ DL Sbjct: 363 RLKLFSHLANVGDTRSLVIHPASTTHRQLADDQKILAGAGPDVVRLSVGIEDKADLIADL 422 Query: 436 EEAL 439 ++AL Sbjct: 423 DQAL 426 Lambda K H 0.317 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 563 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 429 Length adjustment: 32 Effective length of query: 410 Effective length of database: 397 Effective search space: 162770 Effective search space used: 162770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory