Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_020176531.1 A3OQ_RS0116535 hypothetical protein
Query= BRENDA::O58256 (333 letters) >NCBI__GCF_000385335.1:WP_020176531.1 Length = 328 Score = 166 bits (420), Expect = 7e-46 Identities = 109/320 (34%), Positives = 165/320 (51%), Gaps = 17/320 (5%) Query: 4 KVGVLLKMKREALEELKKYADVEIILYPSGEELKGVIGRFDG---IIVSPTTKITREVLE 60 K+ V +++E L+ L+ Y VE +I R G ++ T + L Sbjct: 3 KIVVANWVEKEVLDYLRAYGTVEANTTFEPWSAAELIRRCQGATALLSFMTESVDEAFLS 62 Query: 61 NAERLKVISCHSAGYDNIDLEEATKRGIYVTKVSGLLSEAVAEFTVGLIINLMRKIHYAD 120 L+++SC GYDN D+ +RG+ ++ V LL AE TVGL+I L RKI AD Sbjct: 63 ACPDLRMVSCALKGYDNYDVAACRRRGVALSIVPDLLIGPTAELTVGLMIALGRKILSAD 122 Query: 121 KFIRRGEWESHAKIWTGFKRIESLYGKKVGILGMGAIGKAIARRLIPFGVKLYYWSRHR- 179 ++IR G + + G L G VG++GMGA+G+A+A RL F L Y+S++R Sbjct: 123 RYIRSGAFAGWRPTFYG----TGLAGSTVGLIGMGALGQAVAARLAGFDCSLIYFSQNRL 178 Query: 180 KVNVEKELKARYMDIDELLEKSDIVILALPLTRDTYHIINEERVKKLE-GKYLVNIGRGA 238 E L AR + +DELL +SD V LPLT +T H+++ + +++ G L+N GRG+ Sbjct: 179 TAEQETRLGARKVGLDELLSRSDYVTAVLPLTPETVHLLDAAAIARMKRGALLINTGRGS 238 Query: 239 LVDEKAVTEAIKQGKLKGYATDVFEKE--------PVREHELFKYEWETVLTPHYAGLAL 290 +VDE+AV +A+ G L GYA DVF E P L + T+LT H Sbjct: 239 VVDEEAVADALASGHLGGYAADVFAMEDWALPDHPPAIPPRLLGADNRTILTSHIGSAVT 298 Query: 291 EAQEDVGFRAVENLLKVLRG 310 + + ++ A N++ L G Sbjct: 299 KVRLEIAMEAARNIVDFLEG 318 Lambda K H 0.319 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 13 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 328 Length adjustment: 28 Effective length of query: 305 Effective length of database: 300 Effective search space: 91500 Effective search space used: 91500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory