Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_020177037.1 A3OQ_RS0119050 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_000385335.1:WP_020177037.1 Length = 433 Score = 252 bits (643), Expect = 3e-71 Identities = 164/437 (37%), Positives = 233/437 (53%), Gaps = 14/437 (3%) Query: 356 PIHLDVVKASDKVGVQKALSRPIQKTSEIMHLVNPIIENVRDKGNSALLEYTEKFDGVKL 415 P+ LD+ K L+ + + ++ H V II V +G+ AL+E+++KFD V L Sbjct: 2 PLRLDMRSPDFKSAFDSLLAMKREASEDVDHTVQAIIAAVVARGDEALIEFSKKFDRVDL 61 Query: 416 SNPVLNAPFPEEYFEGLT---EEMKEALDLSIENVRKFHAAQLPTETLEVETQPGVLCSR 472 L P E + + AL L+ E + FH Q P + L GV Sbjct: 62 EALGLRVT-PAEVDAAVAIAPADAVAALRLAHERIIAFHERQKPQD-LRFTDPLGVELGW 119 Query: 473 FPRPIEKVGLYIPGGTAILPSTALMLGVPAQVAQCKEIVFASPPRKSDGKVSPEVVYVAE 532 P+E VGLY+PGGTA PS+ LM PA+VA +V P DGK++P V+ A Sbjct: 120 RWLPVEAVGLYVPGGTASYPSSVLMNAAPAKVAGVSRLVMVVPA--PDGKINPLVLAAAH 177 Query: 533 KVGASKIVLAGGAQAVAAMAYGTETIPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMP 592 G +I GGA AVAA+AYGT+TI V KI+GPGN +V AAK V IDM Sbjct: 178 LAGVDEIYRVGGAHAVAALAYGTKTIAPVAKIVGPGNAYVAAAKRRVFGTV----GIDMI 233 Query: 593 AGPSEVLVIADEDADVDFVASDLLSQAEHGIDSQVILVGVNLSEKKIQEIQDAVHNQALQ 652 AGPSEVL++AD+ A+ +++A+DLL+QAEH +Q IL+ + + ++ AV Q Sbjct: 234 AGPSEVLILADKSANPEWIAADLLAQAEHDSAAQSILITDDAA--LASAVEAAVERQLAN 291 Query: 653 LPRVDIVRKCIAH-STIVLCDGYEEALEMSNQYAPEHLILQIANANDYVKLVDNAGSVFV 711 LPR +I I+ +A+ ++++ APEHL + +A V NAG++F+ Sbjct: 292 LPRKEIAAPSWRDFGAIIEVASLMDAIPLADRLAPEHLEIMAEDAEGIASHVRNAGAIFI 351 Query: 712 GAYTPESCGDYSSGTNHTLPTYGYARQYSGANTATFQKFITAQNITPEGLENIGRAVMCV 771 GAYTPE+ GDY G+NH LPT AR SG N F K + L +G A + + Sbjct: 352 GAYTPEAIGDYVGGSNHVLPTARSARFSSGLNVLDFMKKTSILKCDSASLAVLGPAAVAL 411 Query: 772 AKKEGLDGHRNAVKIRM 788 K EGLD H +V++R+ Sbjct: 412 GKAEGLDAHARSVQMRL 428 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 672 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 433 Length adjustment: 37 Effective length of query: 762 Effective length of database: 396 Effective search space: 301752 Effective search space used: 301752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory