Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_020561536.1 A3OW_RS0100780 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::Q8YY14 (398 letters) >NCBI__GCF_000372865.1:WP_020561536.1 Length = 386 Score = 403 bits (1036), Expect = e-117 Identities = 206/388 (53%), Positives = 265/388 (68%), Gaps = 7/388 (1%) Query: 7 RMQAVQSPIIPVVGELIQNSPGTISLGQGVVSYSPPPEAIELLPRFLADPANNLYKAVEG 66 RM AVQ+PIIPVVGE +N+PG +SLGQG+VSY PPP A++ + F P + LY G Sbjct: 6 RMTAVQAPIIPVVGEWTRNTPGALSLGQGMVSYPPPPAALQAVREFGEKPEHFLYGPASG 65 Query: 67 IPPLLNALTEKLSTFNNIEITTDNCIVVTAGSNMAFMNAILAITSPGDEIILNTPYYFNH 126 P LL + KL T N I+ ++VTAGSNMAF+++ILAI PGDEIIL PYYFNH Sbjct: 66 SPFLLEMIGNKLQTDNGIDTAGGYRVMVTAGSNMAFLSSILAIADPGDEIILPLPYYFNH 125 Query: 127 EMAITMAGCRAVLVETDENYQLCPEAIAQAITPKTRAVVTISPNNPTGVVYCEDLLRNVN 186 EMAI MA C V V T +YQL +A+A AI KTRAVVT+SPNNP+G VY E LR VN Sbjct: 126 EMAIRMANCEPVFVPTGGDYQLDLDALATAINEKTRAVVTVSPNNPSGAVYPEAALRAVN 185 Query: 187 QICANYGIYHISDEAYEYFTYDGVKHVSPASFAGSSEYTISLYSLSKAYGFASWRIGYMV 246 +C +GIYH+SDEAYEYFTYDG H SP S G+ TISLYSLSKAYGFA WRIGY V Sbjct: 186 ALCREHGIYHVSDEAYEYFTYDGAAHFSPGSIPGAEASTISLYSLSKAYGFAGWRIGYAV 245 Query: 247 IPKHLLVAIKKVQDTILICPPVVSQYAALGALQAKPEYLQDHIGALAQPAVGIAQVRQIV 306 P+HL A K+QDT LIC P ++Q+AA GAL A Y + + L A+VR V Sbjct: 246 YPEHLHSAFLKIQDTNLICAPGIAQHAAAGALSAGSAYCKRQLRPL-------AEVRSHV 298 Query: 307 FDYLKQLQGLCNITPADGAFYVFLKVHTQIDAFALVKQLIQEYKVAVIPGTTFGMENGCY 366 L+ LC+ T GAFY L++HT+ + A+V+ LI+++K+A IPG+ FG+++GCY Sbjct: 299 IGRLEPHADLCDFTVTQGAFYFLLQLHTEKNDLAVVESLIRDFKIATIPGSAFGLKDGCY 358 Query: 367 LRVAYGALQKDTVKEGIERLVQGLKTIL 394 LR++YG L V E ++RL++G++ ++ Sbjct: 359 LRLSYGMLNPALVDEAMDRLIRGIRRLV 386 Lambda K H 0.320 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 386 Length adjustment: 31 Effective length of query: 367 Effective length of database: 355 Effective search space: 130285 Effective search space used: 130285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory