Align 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16) (characterized)
to candidate WP_020561662.1 A3OW_RS0101495 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
Query= reanno::pseudo6_N2E2:Pf6N2E2_3839 (245 letters) >NCBI__GCF_000372865.1:WP_020561662.1 Length = 243 Score = 317 bits (813), Expect = 1e-91 Identities = 155/243 (63%), Positives = 191/243 (78%) Query: 1 MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCRRLHLVDLNGAFEGQP 60 ML+IPAIDLKDG CVRLRQGRM++ TVFSDDPV++A +WV G +RLHLVDL+GAF G+P Sbjct: 1 MLLIPAIDLKDGKCVRLRQGRMDEDTVFSDDPVAVAGRWVAAGAKRLHLVDLDGAFAGKP 60 Query: 61 VNGEVVTAIAKRYPNLPIQIGGGIRSLETIEHYVKAGVSYVIIGTKAVKEPEFVAEACRA 120 N E++TAI K +P++P+QIGGGIR +TI+ Y+ AGV YVIIGTKAV P FV + Sbjct: 61 KNAEIITAIVKAFPHVPVQIGGGIRDEDTIQAYLDAGVEYVIIGTKAVNAPHFVRDIAME 120 Query: 121 FPGKVIVGLDAKDGFVATDGWAEVSTVQVIDLAKRFEADGVSAIVYTDIAKDGMMQGCNV 180 +P ++IVGLDAKDG VA DGW+++S VIDLA+ FE DGV AI+YTDI++DGMM G NV Sbjct: 121 YPRRIIVGLDAKDGKVAIDGWSKLSRHDVIDLAQHFEDDGVEAIIYTDISRDGMMSGVNV 180 Query: 181 PFTAALAAATRIPVIASGGIHNLGDIKALLDAKAPGIIGAITGRAIYEGTLDVAEAQAFC 240 TA LA A RIPVIASGGI N+ DI+AL G+IGAITGRAIYEGTLD AEA+ Sbjct: 181 EATARLARAIRIPVIASGGITNIDDIRALGAVAGDGVIGAITGRAIYEGTLDFAEAEKLA 240 Query: 241 DSY 243 +++ Sbjct: 241 ETF 243 Lambda K H 0.320 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 245 Length of database: 243 Length adjustment: 24 Effective length of query: 221 Effective length of database: 219 Effective search space: 48399 Effective search space used: 48399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
Align candidate WP_020561662.1 A3OW_RS0101495 (1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase)
to HMM TIGR00007 (hisA: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (EC 5.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00007.hmm # target sequence database: /tmp/gapView.4007.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00007 [M=231] Accession: TIGR00007 Description: TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-84 266.7 2.1 1e-83 266.5 2.1 1.0 1 lcl|NCBI__GCF_000372865.1:WP_020561662.1 A3OW_RS0101495 1-(5-phosphoribos Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000372865.1:WP_020561662.1 A3OW_RS0101495 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 266.5 2.1 1e-83 1e-83 1 230 [. 3 235 .. 3 236 .. 0.97 Alignments for each domain: == domain 1 score: 266.5 bits; conditional E-value: 1e-83 TIGR00007 1 iiPaiDlkeGkvvrlvqGdkdkktvysddpleaakkfeeegaellHvVDLdgAkegekknlevikkive 69 +iPaiDlk+Gk+vrl qG++d+ tv+sddp+++a ++ + ga++lH+VDLdgA++g++kn+e+i iv+ lcl|NCBI__GCF_000372865.1:WP_020561662.1 3 LIPAIDLKDGKCVRLRQGRMDEDTVFSDDPVAVAGRWVAAGAKRLHLVDLDGAFAGKPKNAEIITAIVK 71 59******************************************************************* PP TIGR00007 70 el.evkvqvGGGiRsleavekllelgverviigtaavenpelvkellkelgsekivvslDakegevavk 137 ++ +v+vq+GGGiR+ ++++++l++gve+viigt+av+ p++v++++ e+ ++i+v+lDak+g+va+ lcl|NCBI__GCF_000372865.1:WP_020561662.1 72 AFpHVPVQIGGGIRDEDTIQAYLDAGVEYVIIGTKAVNAPHFVRDIAMEYP-RRIIVGLDAKDGKVAID 139 98579*********************************************9.9**************** PP TIGR00007 138 GWkekselslvelakkleelgleeiilTdiekdGtlsGvnveltkelvkeaeveviasGGvssiedvka 206 GW + s+ ++++la+++e+ g+e+ii+Tdi++dG++sGvnve+t +l+++ +++viasGG+++i+d++a lcl|NCBI__GCF_000372865.1:WP_020561662.1 140 GWSKLSRHDVIDLAQHFEDDGVEAIIYTDISRDGMMSGVNVEATARLARAIRIPVIASGGITNIDDIRA 208 ********************************************************************* PP TIGR00007 207 lkk...lgvkgvivGkAlyegklklke 230 l + gv g+i G+A+yeg+l++ e lcl|NCBI__GCF_000372865.1:WP_020561662.1 209 LGAvagDGVIGAITGRAIYEGTLDFAE 235 988666899999***********9877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (243 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.17 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory