Align Argininosuccinate lyase; ASAL; EC 4.3.2.1; Arginosuccinase (uncharacterized)
to candidate WP_020562013.1 A3OW_RS23915 argininosuccinate lyase
Query= curated2:Q12X66 (491 letters) >NCBI__GCF_000372865.1:WP_020562013.1 Length = 509 Score = 217 bits (552), Expect = 9e-61 Identities = 145/457 (31%), Positives = 233/457 (50%), Gaps = 8/457 (1%) Query: 9 RLASVPDEEIIN--FTSSMNADKWIFKADILVDLAHTIMLKERKIIKAEDCKKILEGLLT 66 RL S P ++ F ++ +F+A DLA+T+ E I E +++L LL Sbjct: 20 RLKSAPAANMVQSVFALELSHQNGLFEAMGQADLAYTLTAMELNTIPLEAGRQLLASLLE 79 Query: 67 IKEEGIE-KLDHTYEDIHISLESRLIDMVGEDTGGRMHSGRSRNDEVATCIRLTLRNDLL 125 ++ + + D D++ + E+ L + D G + +GR+R + + +R +LL Sbjct: 80 LQAKPVSFDTDPARGDMYTNREAWLAERT--DAVGWLGAGRARREATTAAFFIVMREELL 137 Query: 126 LLMEELIALRNTLNDTSSENLNTLMPGFTHLQHAQPTTLAHHLTAHANAIGRDLERTMDC 185 L + ++ L L + + ++MP +T+LQ AQPTT H+L A + RDLER Sbjct: 138 ELGQAVVRLAEALVAQADAHKQSVMPDYTYLQAAQPTTFGHYLLGFAYPLLRDLERLEAL 197 Query: 186 YKRVNLSPLGAAAFASTGFDLDRERTCKLLGFDGLIENSMDAVSSRDFLIESASVFANLM 245 + R N SP+G + + R + +LLGF G+IE+ DA+ D IE+AS+ Sbjct: 198 FARFNRSPMGCGSTNGSRLAQGRRQMAELLGFAGVIEHGRDAMWQPDLCIETASILTACA 257 Query: 246 INLSKVAEEIVIWSTSEFAFIELDDRYASTSSIMPQKKNPDTAELLRGKSGVTIGSLMSL 305 INLS++AE++ I+ T EF +ELDD +A S IMPQKKNP +RG + IG S+ Sbjct: 258 INLSRLAEDLQIYGTQEFGLVELDDSHARASKIMPQKKNPFALTHIRGVANRMIGLSASV 317 Query: 306 LAICKALPLSYNRDLQEATPNIMQSLETTRASVRIMNGMIATMSINKENMAGLATAGFTT 365 A + P + + +++ +V +M ++A +S N E L +G+ Sbjct: 318 SATART-PSGQPDNRLFLYGELPEAMTLVLNAVELMAEVLAKISFNSERGRQLVASGWVM 376 Query: 366 ATELADTMVRVCDIPFRTAHQIVGVLARGSGEPTLGEIDAVAHNVIGESLSSRGL--TEK 423 AT+LA+T+V+ C + FR AH++V LA E L E+D N GE + R L TE Sbjct: 377 ATDLAETLVQECGLDFRGAHRLVASLASEFPEKNLRELDHDTVNRFGEIILGRRLAVTEN 436 Query: 424 MVKEALDPILNVSKRSVIGGPSPESMERLIESSRERI 460 + ALD + R GG + M+R++ RER+ Sbjct: 437 QLSMALDAHRALEARKEPGGTAVACMDRMMAECRERL 473 Lambda K H 0.317 0.132 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 491 Length of database: 509 Length adjustment: 34 Effective length of query: 457 Effective length of database: 475 Effective search space: 217075 Effective search space used: 217075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
Align candidate WP_020562013.1 A3OW_RS23915 (argininosuccinate lyase)
to HMM TIGR00838 (argH: argininosuccinate lyase (EC 4.3.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00838.hmm # target sequence database: /tmp/gapView.25007.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00838 [M=455] Accession: TIGR00838 Description: argH: argininosuccinate lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-87 280.6 0.0 1.7e-87 280.3 0.0 1.0 1 lcl|NCBI__GCF_000372865.1:WP_020562013.1 A3OW_RS23915 argininosuccinate l Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000372865.1:WP_020562013.1 A3OW_RS23915 argininosuccinate lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 280.3 0.0 1.7e-87 1.7e-87 4 454 .. 19 473 .. 17 474 .. 0.91 Alignments for each domain: == domain 1 score: 280.3 bits; conditional E-value: 1.7e-87 TIGR00838 4 gRlkkeldkavae..fnaslsfDkelaeaDiegsiahtkaLakagilteeeakklieaLeelkeevkeg 70 +Rlk+++ ++ + f+ ls+ + l+ea ++++a+t + ++ + + e ++l ++L el+ + + lcl|NCBI__GCF_000372865.1:WP_020562013.1 19 SRLKSAPAANMVQsvFALELSHQNGLFEAMGQADLAYTLTAMELNTIPLEAGRQLLASLLELQAKPVS- 86 567766655553323888899999**************************************998877. PP TIGR00838 71 klelevdaeDiHlavErelidkvgedvgkklhtgrsRnDqvatdlrlylrdkvkelaealkdllkalve 139 +++++ D++++ E+ l +++ vg l +gr+R + ++ + + +r+++ el +a+ l +alv lcl|NCBI__GCF_000372865.1:WP_020562013.1 87 -FDTDPARGDMYTNREAWLAERTD-AVG-WLGAGRARREATTAAFFIVMREELLELGQAVVRLAEALVA 152 .9********************98.666.**************************************** PP TIGR00838 140 kAekevetlmpgytHLqrAqPitlaHhllayaemlerDleRlldalkRvnksPlGsgAlagtsfeidre 208 +A+++++ +mp yt+Lq AqP+t++H+ll +a l rDleRl + R n+sP+G+g g+ ++ r+ lcl|NCBI__GCF_000372865.1:WP_020562013.1 153 QADAHKQSVMPDYTYLQAAQPTTFGHYLLGFAYPLLRDLERLEALFARFNRSPMGCGSTNGSRLAQGRR 221 ********************************************************************* PP TIGR00838 209 llaelLgFdavvensldavsdRDfiiEllsaaallmvhlsrlaEelilfsseEfgfvelsdevssgssi 277 ++aelLgF+ v+e+ da+ + D iE+ s ++ ++++lsrlaE+l ++ ++Efg+vel+d+ + +s i lcl|NCBI__GCF_000372865.1:WP_020562013.1 222 QMAELLGFAGVIEHGRDAMWQPDLCIETASILTACAINLSRLAEDLQIYGTQEFGLVELDDSHARASKI 290 ********************************************************************* PP TIGR00838 278 mPqKKnpDvaEliRgktgrviGnltglltilKalPlaYnkDlqEdkealfdalktveellevvtgllke 346 mPqKKnp ++ iRg + r+iG +++ ++ + +P+ + +l +a++ v +++e+++ +l++ lcl|NCBI__GCF_000372865.1:WP_020562013.1 291 MPQKKNPFALTHIRGVANRMIGLSASVSATAR-TPSGQPDNRLFLYGELPEAMTLVLNAVELMAEVLAK 358 **********************7666666655.56655444445677899******************* PP TIGR00838 347 lkvnkerleeaakknfalatdlAdylvrk.GvPFReaheivGevvakaiekGk.kleeltleelqkl.. 411 + +n+er +++++++++ atdlA++lv++ G+ FR ah++v +++ + ek + +l++ t++++ ++ lcl|NCBI__GCF_000372865.1:WP_020562013.1 359 ISFNSERGRQLVASGWVMATDLAETLVQEcGLDFRGAHRLVASLASEFPEKNLrELDHDTVNRFGEIil 427 **********************************************99999555666666666655533 PP TIGR00838 412 ..sekleed.vlevldleeavekrdakGGtakeevekaieeakael 454 + +++e+ + +ld ++a+e+r+ GGta + + ++++e +++l lcl|NCBI__GCF_000372865.1:WP_020562013.1 428 grRLAVTENqLSMALDAHRALEARKEPGGTAVACMDRMMAECRERL 473 3334566666*******************************99987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (455 nodes) Target sequences: 1 (509 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 9.45 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory