Align Methionine synthase component, methyltransferase domain (EC:2.1.1.13) (characterized)
to candidate WP_020562591.1 A3OW_RS0106365 methionine synthase
Query= reanno::Phaeo:GFF1321 (338 letters) >NCBI__GCF_000372865.1:WP_020562591.1 Length = 1224 Score = 109 bits (272), Expect = 4e-28 Identities = 104/333 (31%), Positives = 151/333 (45%), Gaps = 49/333 (14%) Query: 6 TTLLETKDA---LLADGATGTNLFNMGLQS----GDAPELWNVD-----------EPKKI 47 TTLL+ + A L DGA GT + + L G+ W+ D +P I Sbjct: 4 TTLLKKQLAQRILFLDGAMGTMIQSYKLDEKDYRGERFAAWDSDLKGNNDLLSLTQPAII 63 Query: 48 TALYQGAVDAGSDLFLTNTFGGTAARLKLHDAHRRVRELNVAGAELG-RNVADRSERKIA 106 A++ +DAG+D+ TNTF T + + E+N+ A L AD S R A Sbjct: 64 KAIHSAYLDAGADIIETNTFNATRIAMADYRMESLAYEINLESARLACEAAADYSARTPA 123 Query: 107 ----VAGSVGPTGEI--MQP------VGELSHALAVEMFHEQAEALKEGGVDVLWLETIS 154 VAG +GPT M P ++ E + E L +GG D+L +ET+ Sbjct: 124 KPRFVAGVLGPTNRTASMSPDVNDPGFRNITFDELAEAYTESVRGLIDGGADILLIETVF 183 Query: 155 APEEYRAAAEA---------FKLADMPWCGTMSFDTAGRTMMGVTSADMAQLVEEFDPAP 205 +AA A +KL M GT++ D +GRT+ G T A ++ +P Sbjct: 184 DTLNAKAAIFAVEQYFDSIGYKLPVMI-SGTIT-DASGRTLSGQTVAAFWHSLKHVEP-- 239 Query: 206 LAFGANCGTGASDILRTVLGFAAQGTTRPIISKGNAGIPKYVDGHIHYDGTPTLMGEYAA 265 ++FG NC GA ++ + + A+ T + + NAG+P YD TP M E A Sbjct: 240 ISFGFNCALGARELRQHIDELASIADTH-VSAHPNAGLPNEFG---EYDETPEAMAEELA 295 Query: 266 -MARDCGAKIIGGCCGTMPDHLRAMREALDTRP 297 AR +IGGCCGT PDH+RA+ A+ P Sbjct: 296 DWARSGYLNVIGGCCGTTPDHIRAIVAAVQKYP 328 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 888 Number of extensions: 52 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 1224 Length adjustment: 38 Effective length of query: 300 Effective length of database: 1186 Effective search space: 355800 Effective search space used: 355800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory