Align Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 (characterized)
to candidate WP_020564337.1 A3OW_RS0115365 aspartate-semialdehyde dehydrogenase
Query= SwissProt::P23247 (337 letters) >NCBI__GCF_000372865.1:WP_020564337.1 Length = 340 Score = 443 bits (1140), Expect = e-129 Identities = 218/339 (64%), Positives = 269/339 (79%), Gaps = 3/339 (0%) Query: 1 MSQQFNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVE 60 M++ +NVA+ GATGAVGE ML +L+ER FPV E++ LAS +S GK F G+++ V+++ Sbjct: 1 MTKVYNVAVVGATGAVGEAMLSILEERNFPVGEVYALASSKSVGKRIPFKGRSLVVEDLA 60 Query: 61 EFDWSQVHIALFSAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAE 120 FD+S+ I LFSAGG +SA++AP AA AG +VIDNTSHFRYD DIPLVVPEVNPE IAE Sbjct: 61 TFDFSKAQIGLFSAGGAVSAEYAPKAAAAGCIVIDNTSHFRYDDDIPLVVPEVNPEKIAE 120 Query: 121 FRNRNIIANPNCSTIQMLVALKPIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLL 180 ++NR IIANPNCSTIQMLVALKPIYDAVGI RINV TYQ+VSG GK GIDE+A QTAKLL Sbjct: 121 YKNRGIIANPNCSTIQMLVALKPIYDAVGIARINVCTYQAVSGTGKKGIDEVATQTAKLL 180 Query: 181 NGYPAETNTFSQQIAFNCIPQIDQFMDNGYTKEEMKMVWETQKIFNDPSIMVNPTCVRVP 240 NG P E+ + +QIAFN +PQID F+DNGYTKEEMKMVWETQKI D ++ VN T VRVP Sbjct: 181 NGQPIESRVYPKQIAFNVLPQIDVFLDNGYTKEEMKMVWETQKILGDAAVKVNATAVRVP 240 Query: 241 VFYGHAEAVHVETRAPIDAEQVMDMLEQTDGIELF---RGADFPTQVRDAGGKDHVLVGR 297 VFYGH+EAVH+ET IDA+ V +LE+ G+++ + +PT V ++ G D V VGR Sbjct: 241 VFYGHSEAVHIETLKKIDAQAVRSLLEKAPGVKVLDERKNGGYPTAVTESSGHDDVFVGR 300 Query: 298 VRNDISHHSGINLWVVADNVRKGAATNAVQIAELLVRDY 336 +R D+SH GI+LWVV DNVRKGAA N+VQIAE+LV++Y Sbjct: 301 IREDVSHPQGIDLWVVGDNVRKGAALNSVQIAEVLVKNY 339 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 340 Length adjustment: 28 Effective length of query: 309 Effective length of database: 312 Effective search space: 96408 Effective search space used: 96408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_020564337.1 A3OW_RS0115365 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.23961.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-141 455.2 0.9 7.8e-141 455.0 0.9 1.0 1 lcl|NCBI__GCF_000372865.1:WP_020564337.1 A3OW_RS0115365 aspartate-semiald Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000372865.1:WP_020564337.1 A3OW_RS0115365 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 455.0 0.9 7.8e-141 7.8e-141 1 339 [] 6 338 .. 6 338 .. 0.98 Alignments for each domain: == domain 1 score: 455.0 bits; conditional E-value: 7.8e-141 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsa 69 nva+vGatGavG+ +l +Leernfp+ ++++las++s Gk++ fkg+ l ve++ +++f++ +i lfsa lcl|NCBI__GCF_000372865.1:WP_020564337.1 6 NVAVVGATGAVGEAMLSILEERNFPVGEVYALASSKSVGKRIPFKGRSLVVEDLATFDFSKAQIGLFSA 74 79******************************************************************* PP TIGR01296 70 GgsvskefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkp 138 Gg+vs e+apkaa+ag+iviDnts fr d+d+PLvvpevn e+++e k++giianPnCstiq++v+Lkp lcl|NCBI__GCF_000372865.1:WP_020564337.1 75 GGAVSAEYAPKAAAAGCIVIDNTSHFRYDDDIPLVVPEVNPEKIAEYKNRGIIANPNCSTIQMLVALKP 143 ********************************************************************* PP TIGR01296 139 lkdeaklkrvvvstYqavsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidkl 207 ++d++++ r+ v tYqavsG+Gkkg++e++ qt l+g+ +e + ++kqiafn++p+id + lcl|NCBI__GCF_000372865.1:WP_020564337.1 144 IYDAVGIARINVCTYQAVSGTGKKGIDEVATQTAKLLNGQPIE-------SRVYPKQIAFNVLPQIDVF 205 **********************************999998777.......699**************** PP TIGR01296 208 kedGytkeelkllfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvv 276 ++Gytkee+k+++et+kilg+ +kv at+vrvPvf+ghse+v+ie+ k+++++ v+ lL++apgv+v lcl|NCBI__GCF_000372865.1:WP_020564337.1 206 LDNGYTKEEMKMVWETQKILGDAAVKVNATAVRVPVFYGHSEAVHIETLKKIDAQAVRSLLEKAPGVKV 274 ********************************************************************* PP TIGR01296 277 iddpsenlyptPl.eavgkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaellike 339 +d+ ++ ypt + e +g+d+vfvgrir+D+s+ +g++l+vv+Dn+rkGaaln+vqiae l+k+ lcl|NCBI__GCF_000372865.1:WP_020564337.1 275 LDERKNGGYPTAVtESSGHDDVFVGRIREDVSHPQGIDLWVVGDNVRKGAALNSVQIAEVLVKN 338 ***********983689********************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (340 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.19 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory