Align imidazole glycerol-phosphate synthase (subunit 2/2) (EC 4.3.2.10) (characterized)
to candidate WP_022948100.1 H035_RS0106020 imidazole glycerol phosphate synthase subunit HisF
Query= BRENDA::Q5NMD6 (255 letters) >NCBI__GCF_000421465.1:WP_022948100.1 Length = 252 Score = 330 bits (845), Expect = 2e-95 Identities = 159/251 (63%), Positives = 200/251 (79%) Query: 1 MTLCTRIIPCLDVADGRVVKGVNFTDLMDAGDPVEQAKVYDAAGADELCFLDISASHEGR 60 M L RIIPCLDV GRVVKGV F D+ DAGDPVE A+ YD GADEL FLDI+ASHEGR Sbjct: 1 MGLAKRIIPCLDVDRGRVVKGVQFVDIRDAGDPVEIARRYDEEGADELTFLDITASHEGR 60 Query: 61 GTMLDVVARTAEVCFMPLTVGGGVRQVEDARALLLAGADKVAVNSAAVARPELVAEIADR 120 TM+ VV + A F+PLTVGGG+R ++D R +L AGADKVA+N+AAV PE V + A+R Sbjct: 61 DTMVHVVEQVAGCVFIPLTVGGGIRTLDDIRRMLNAGADKVAINTAAVFHPEFVQQAAER 120 Query: 121 FGAQCVVAAIDARRNGDHWEVYTHGGRRPTGINALDHALNLTRLGAGEILLTSMDKDGTR 180 FG+QC+V AIDA+R GDHWE++THGGR+PTG++A+D A + LGAGEILLTSMD+DGT+ Sbjct: 121 FGSQCIVVAIDAKRVGDHWEIFTHGGRKPTGLDAVDWAAKMEALGAGEILLTSMDRDGTK 180 Query: 181 DGYDLELTRLVADSVPVPVIASGGVGNLDHMVEGVTKGHASALLAASIFHFGQYSLAEAH 240 +G+DL LTR V++ V +PVIASGGVGNL+H+ EG+ +G A A+LAASIFHFG+YS+ +A Sbjct: 181 EGFDLALTRAVSERVGIPVIASGGVGNLEHLAEGIVEGRADAVLAASIFHFGEYSIHQAK 240 Query: 241 EALAKAGLTVR 251 L + G+ VR Sbjct: 241 AYLTERGIEVR 251 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 252 Length adjustment: 24 Effective length of query: 231 Effective length of database: 228 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_022948100.1 H035_RS0106020 (imidazole glycerol phosphate synthase subunit HisF)
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00735.hmm # target sequence database: /tmp/gapView.19094.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00735 [M=254] Accession: TIGR00735 Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-122 393.3 1.6 2.3e-122 393.1 1.6 1.0 1 lcl|NCBI__GCF_000421465.1:WP_022948100.1 H035_RS0106020 imidazole glycero Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000421465.1:WP_022948100.1 H035_RS0106020 imidazole glycerol phosphate synthase subunit HisF # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 393.1 1.6 2.3e-122 2.3e-122 1 254 [] 2 251 .. 2 251 .. 0.99 Alignments for each domain: == domain 1 score: 393.1 bits; conditional E-value: 2.3e-122 TIGR00735 1 mlakriipCLdvkdgrvvkGvqfknlrdaGdpvelakkydeeGadelvflditassekretmlevverv 69 +lakriipCLdv++grvvkGvqf ++rdaGdpve+a++ydeeGadel+flditas+e+r+tm++vve+v lcl|NCBI__GCF_000421465.1:WP_022948100.1 2 GLAKRIIPCLDVDRGRVVKGVQFVDIRDAGDPVEIARRYDEEGADELTFLDITASHEGRDTMVHVVEQV 70 59******************************************************************* PP TIGR00735 70 aekvfiPltvgGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakreaene 138 a vfiPltvgGGi++++d++++l+aGadkv+intaav +pe+++++a+rfGsq+ivvaidakr+ + lcl|NCBI__GCF_000421465.1:WP_022948100.1 71 AGCVFIPLTVGGGIRTLDDIRRMLNAGADKVAINTAAVFHPEFVQQAAERFGSQCIVVAIDAKRVGD-- 137 ****************************************************************997.. PP TIGR00735 139 eakyevtikgGrestdldvvewakeveelGaGeilltsmdkdGtksGydlellkkvkeavkiPviasgG 207 ++e+ ++gGr+ t+ld+v+wa+++e+lGaGeilltsmd+dGtk+G+dl+l+++v+e+v iPviasgG lcl|NCBI__GCF_000421465.1:WP_022948100.1 138 --HWEIFTHGGRKPTGLDAVDWAAKMEALGAGEILLTSMDRDGTKEGFDLALTRAVSERVGIPVIASGG 204 ..5****************************************************************** PP TIGR00735 208 aGkaehleeaflkgkadaaLaasvfhkreltieevkeylaergvkvr 254 +G+ ehl+e++++g+ada+Laas+fh++e++i++ k+yl+erg++vr lcl|NCBI__GCF_000421465.1:WP_022948100.1 205 VGNLEHLAEGIVEGRADAVLAASIFHFGEYSIHQAKAYLTERGIEVR 251 **********************************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (254 nodes) Target sequences: 1 (252 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 7.95 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory