Align Phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_022948200.1 H035_RS0106600 D-2-hydroxyacid dehydrogenase
Query= reanno::SB2B:6938941 (308 letters) >NCBI__GCF_000421465.1:WP_022948200.1 Length = 324 Score = 149 bits (376), Expect = 9e-41 Identities = 93/269 (34%), Positives = 139/269 (51%), Gaps = 9/269 (3%) Query: 43 WLAEPGLAAPLVNHASGLRWMQSTFAGVDLLVKPR-QRRDYLLTNVRGIFGPLMSEYLFG 101 WL E P +H S W+ +T AGVD L+ P D +LTN RGIF ++EY+ G Sbjct: 58 WLRE---VWPREHHIS---WVHATSAGVDALMFPELTESDIILTNARGIFDRGIAEYVLG 111 Query: 102 YLLARQREHDLYKSQQQQKLWLPGSYKTLQGSELLLLGTGSIAKHLAQTAKHFGMKVAGI 161 +L ++ Q+Q W + + L++G GSI + +A + GM+V G Sbjct: 112 AVLLFAKDTLGNLDYQRQHRWRHRETELIHKQTALVVGAGSIGREVAALLRAVGMRVIGT 171 Query: 162 NRSAKATEGFDEVATLEALPTLMARADAIASILPSTEATRGILNENILARMKPDAVLFNL 221 R A+ E FD V +AL L+ AD + P T T G+ + + RM+ A L N+ Sbjct: 172 ARHAREDERFDAVYGEDALDELLPSADYVVITAPLTPRTEGLFDRSAFERMQSGARLINV 231 Query: 222 GRGDVLDLDALERQLRQHPQQQAVLDVFNQEPLPEDHPIWGLGNVIVTPHIAAP--SFPE 279 GRG ++ LDAL LR A LDVF QEPLP D P+W + NV+++ H+A + Sbjct: 232 GRGPIVKLDALIEALRNGQIDGAALDVFEQEPLPADSPLWDMPNVMISAHMAGDFIGWRR 291 Query: 280 QVAEIFSSNYHKFLLGETLSHRVNFERGY 308 + E F N+ +++ G + + V +RGY Sbjct: 292 ALGEQFVENFRRWVAGSPMLNVVEKKRGY 320 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 324 Length adjustment: 27 Effective length of query: 281 Effective length of database: 297 Effective search space: 83457 Effective search space used: 83457 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory