Align branched-chain-amino-acid aminotransferase; EC 2.6.1.42 (characterized)
to candidate WP_022949156.1 H035_RS0111660 branched-chain-amino-acid transaminase
Query= CharProtDB::CH_024500 (309 letters) >NCBI__GCF_000421465.1:WP_022949156.1 Length = 292 Score = 147 bits (371), Expect = 3e-40 Identities = 101/291 (34%), Positives = 145/291 (49%), Gaps = 9/291 (3%) Query: 10 WFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKIYR 69 W NG ++ A V V H L YG VFEGIR Y FR H+QRL DS R Sbjct: 8 WINGRLLPGNAATVPVTDHGLLYGDGVFEGIRFYRRR----AFRLAAHLQRLADSCAAIR 63 Query: 70 FPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPWGA 129 + + L A +VI Y+R ++ G MG+NP +VI+ A Sbjct: 64 LTLPCPRERLTRAVEEVIAAFAEDDGYLRLIVTRGSGPMGLNPEDCTRPNVILIATRL-Q 122 Query: 130 YLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALDVN 189 + +G+ ++++ R + + K+ NYL+ +L EA + G E + L+ Sbjct: 123 LVSERKRREGVRVIIAATRRLPADGLDPRIKSL-NYLNPILARMEAHQAGADEAVMLNRA 181 Query: 190 GYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQVLSRESLYL 249 G I+EG +N+F V+ G L TPP AL GITR+ I+ LA++ GI V E L+ LY Sbjct: 182 GRIAEGTADNVFVVRQGELATPPPVEGALAGITRELIMGLARDAGISVAEIPLAPYDLYT 241 Query: 250 ADEVFMSGTAAEITPVRSVDGIQVGEGRC-GPVTKRIQQAFFGLFTGETED 299 A E F++GT AE+ PV VDG +G+ C GPV +++ F L E D Sbjct: 242 AGECFLTGTGAELIPVAEVDGRPMGD--CPGPVFLELRRRFHALVQEECGD 290 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 292 Length adjustment: 27 Effective length of query: 282 Effective length of database: 265 Effective search space: 74730 Effective search space used: 74730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory