Align Sugar-phosphatase AraL; EC 3.1.3.23; Arabinose operon protein AraL; Phosphoserine phosphatase; EC 3.1.3.3 (uncharacterized)
to candidate WP_022949996.1 H035_RS0116140 haloacid dehalogenase
Query= curated2:P94526 (272 letters) >NCBI__GCF_000421465.1:WP_022949996.1 Length = 286 Score = 134 bits (337), Expect = 2e-36 Identities = 90/270 (33%), Positives = 140/270 (51%), Gaps = 11/270 (4%) Query: 8 DTPVSPA-GILIDLDGTVFRGNELIEGAREAIKTLRRMGKKIVFLSNRGNISRAMCRKKL 66 D P+ A +++D+DG ++RG+E + G RE +TLR G + +N + + KL Sbjct: 12 DVPLHNARALIVDMDGVLWRGSEPMPGIREFFRTLRGAGMPFILATNNASSTPRNYVAKL 71 Query: 67 LGAGIETDVNDIVLSSSVTAAFLKKHY--RFSKVWVLGEQGLVDELR-----LAGVQNAS 119 G+E +I+ S TA +L +H+ +KV VLGE+GL L L G + Sbjct: 72 ARMGVEVRAEEILTSGIATARYLAEHHDPGATKVCVLGEEGLRQPLAEAGFILTGWHKET 131 Query: 120 EPKEADWLVISLHETLTYDDLNQAFQAAAGGARIIATNKDRSFPNEDGNAIDVAGMIGAI 179 + AD +V+ ETLT+D L A GAR I TN D + P E G ++ A+ Sbjct: 132 DDWRADIVVVGKDETLTWDKLATATLNLNAGARFIGTNADTTLPMELGFTHGTGAILAAL 191 Query: 180 ETSAQAKTELVVGKPSWLMAEAACTAMGLSAHECMIIGDSIESDIAMGKLYGMKSALVLT 239 +A T ++GKP +M A +G+ H + IGD +E+DI G++S LVLT Sbjct: 192 -IAATGLTPSIIGKPEPIMYRQALGRLGVEPHAVVAIGDRLETDILGAVRAGIRSLLVLT 250 Query: 240 GSAKQGEQRL--YTPDYVLDSIKDVTKLAE 267 G + + + + Y PD+VL I+ VTK+ + Sbjct: 251 GVSTEADLKRAEYRPDWVLADIEAVTKVLQ 280 Lambda K H 0.317 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 7 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 286 Length adjustment: 26 Effective length of query: 246 Effective length of database: 260 Effective search space: 63960 Effective search space used: 63960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory