Align ornithine aminotransferase (EC 2.6.1.13) (characterized)
to candidate WP_024850313.1 N745_RS0101155 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= BRENDA::B1A0U3 (469 letters) >NCBI__GCF_000526715.1:WP_024850313.1 Length = 442 Score = 156 bits (394), Expect = 2e-42 Identities = 120/394 (30%), Positives = 193/394 (48%), Gaps = 36/394 (9%) Query: 25 TQSNASSSSQTIIDKEHQHSAHNYHPLP-----IVFAHAKGSSVWDPEGNKYIDFLSGYS 79 ++ N S + ++ + QH H Y +P I A +GS + +G + +D +S + Sbjct: 4 SKPNLSEHWKELLAFDQQHIWHPYAKMPADTPAIGVASTQGSVITLADGTELVDGMSSWW 63 Query: 80 AVNQGHCHPKILKALHDQADRLT-VSSRAFYNDRFPVFAEYLTALF--GYDMVLPMNTGA 136 A G+ HPKI +A+H+Q D + + ++ ++ L L G D V +++G+ Sbjct: 64 AALHGYNHPKIQQAMHEQIDIMPHIMFGGLTHEPAIELSKRLVKLTPEGLDKVFLVDSGS 123 Query: 137 EGVETALKLARKWGYEKKKIPNDEALIVSCCGCFNGRTLGVISMSCD--NEATRGFGPLM 194 +E A+K+A ++ K + PN L+ G ++G T +++ CD N F ++ Sbjct: 124 VAMEVAIKMALQYWVSKDQ-PNKNRLLTVRNG-YHGDTFATMAV-CDPVNGMHSLFSEIL 180 Query: 195 PGH-----------LKVDFGDAEAIERIFKEKGDRVAAFILEPI-QGEAGVVIPPDGYLK 242 H ++ D D +++ + +E + +AA +EPI QG G+ YLK Sbjct: 181 TQHYFAPEPEMGFDIESDNQDINSLKTMLEEHHNNIAAVTIEPIVQGAGGMRFYRPDYLK 240 Query: 243 AVRDLCSKYNVLMIADEIQTGLARTGKMLACDWEDVRPDVVILGKALGGGILPVSAVLAD 302 +R LC +Y VL+IADEI TG RTGK+ AC+W + PD++ LGK L GG + ++A LA Sbjct: 241 QLRQLCDEYGVLLIADEIATGFGRTGKLFACEWAGITPDIMTLGKTLTGGHISLAATLAT 300 Query: 303 KDVMLCI-------KPG--QHGSTFGGNPLASAVAIAALEVIKEERLTERSTKLGGELLG 353 DV I PG HG TF GNPLA A AIA ++V+ + ++ Sbjct: 301 TDVSDTISSNVGDLNPGLLMHGPTFMGNPLACAAAIANIDVLMNSPWQDNIQRIEEHFTE 360 Query: 354 LLHKIQKKHPEHVKEVRGKGLFIGVELNSESLSP 387 L + K E V + R G +EL L P Sbjct: 361 TL--LPLKELEGVADARVLGAIGVIELERSDLGP 392 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 433 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 469 Length of database: 442 Length adjustment: 33 Effective length of query: 436 Effective length of database: 409 Effective search space: 178324 Effective search space used: 178324 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory