Align Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 (uncharacterized)
to candidate WP_024850313.1 N745_RS0101155 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= curated2:P59317 (406 letters) >NCBI__GCF_000526715.1:WP_024850313.1 Length = 442 Score = 161 bits (407), Expect = 4e-44 Identities = 112/345 (32%), Positives = 182/345 (52%), Gaps = 30/345 (8%) Query: 32 QGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQGETLWHIS-NVFTNEPALRLG 90 QGS I G E VD G+ HP + A+ Q + + HI T+EPA+ L Sbjct: 43 QGSVITLADGTELVDGMSSWWAALHGYNHPKIQQAMHEQIDIMPHIMFGGLTHEPAIELS 102 Query: 91 RKLIEAT--FAERVVFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGRSLFT 148 ++L++ T ++V ++SG+ A E A K+A Y + P K +++ N +HG + T Sbjct: 103 KRLVKLTPEGLDKVFLVDSGSVAMEVAIKMALQYWVSKDQPNKNRLLTVRNGYHGDTFAT 162 Query: 149 VSV-----GGQPKYSD-----GFGPKPADIIHVPFN--DLHAVKAVMDDH---TCAVVVE 193 ++V G +S+ F P+P + + D++++K ++++H AV +E Sbjct: 163 MAVCDPVNGMHSLFSEILTQHYFAPEPEMGFDIESDNQDINSLKTMLEEHHNNIAAVTIE 222 Query: 194 PI-QGEGGVTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILT 252 PI QG GG+ P++L+ LR+LCD++ LL+ DE+ G GRTG LFA G+TPDI+T Sbjct: 223 PIVQGAGGMRFYRPDYLKQLRQLCDEYGVLLIADEIATGFGRTGKLFACEWAGITPDIMT 282 Query: 253 SAKAL-GGGFPVSAMLTTAEIASA-------FHPG--SHGSTYGGNPLACAVAGAAFDII 302 K L GG ++A L T +++ +PG HG T+ GNPLACA A A D++ Sbjct: 283 LGKTLTGGHISLAATLATTDVSDTISSNVGDLNPGLLMHGPTFMGNPLACAAAIANIDVL 342 Query: 303 NTPEVLEGIQAKRQHFVDHLQKIDQQYDVFSDIRGMGLLIGAELK 347 + IQ +HF + L + ++ + +D R +G + EL+ Sbjct: 343 MNSPWQDNIQRIEEHFTETLLPL-KELEGVADARVLGAIGVIELE 386 Lambda K H 0.322 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 474 Number of extensions: 26 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 442 Length adjustment: 32 Effective length of query: 374 Effective length of database: 410 Effective search space: 153340 Effective search space used: 153340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory