Align glutamate N-acetyltransferase/amino-acid acetyltransferase; EC 2.3.1.35 2.3.1.1 (characterized)
to candidate WP_024850710.1 N745_RS0103280 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
Query= CharProtDB::CH_000559 (406 letters) >NCBI__GCF_000526715.1:WP_024850710.1 Length = 401 Score = 364 bits (935), Expect = e-105 Identities = 195/395 (49%), Positives = 262/395 (66%), Gaps = 6/395 (1%) Query: 16 IDGIALYTAQAGVKKPGHTDLTLIAVAAGSTVGAVFTTNRFCAAPVHIAKSHLFDEDGVR 75 + G+ L T A +KK G D L+ + A FT N FCAAPV +AK HL + + Sbjct: 9 VQGVYLGTTCAKIKKSGAEDFVLLQFNDAAVTVATFTQNAFCAAPVTLAKRHLAVK-APK 67 Query: 76 ALVINTGNANAGTGAQGRIDALAVCAAAARQIGCKPNQVMPFSTGVILEPLPADKIIAAL 135 ALVIN+GNANAGTG QG +DA CA A ++GC ++V+PFSTGVI + LP K+ A+ Sbjct: 68 ALVINSGNANAGTGKQGMMDAEQTCAWVANELGCSADEVLPFSTGVIGQNLPMQKVQQAI 127 Query: 136 P----KMQPAFWNEAARAIMTTDTVPKAASREGKVGDQHTVRATGIAKGSGMIHPNMATM 191 P ++ W++A + IMTTDTV K S + + H + TGI+KGSGMIHPNMATM Sbjct: 128 PMAAANLKIDGWSDAMKGIMTTDTVEKIYSEKVSI-QGHEITLTGISKGSGMIHPNMATM 186 Query: 192 LGFIATDAKVSQPVLQLMTQEIADETFNTITVDGDTSTNDSFVIIATGKNSQSEIDNIAD 251 LGF+ATDAK+++ LQ + + +FN ITVDGDTSTND+ + AT + I++ Sbjct: 187 LGFVATDAKITRECLQQAMTDAVNLSFNRITVDGDTSTNDACTLTATQQADMPTIEDSHS 246 Query: 252 PRYAQLKELLCSLALELAQAIVRDGEGATKFITVRVENAKTCDEARQAAYAAARSPLVKT 311 Y + L + LAQ IVRDGEGATKF+ V VENA++ +EA + A+A A SPLVKT Sbjct: 247 MAYQEFANALNHCMMTLAQKIVRDGEGATKFVAVEVENARSSEEALKVAHAVALSPLVKT 306 Query: 312 AFFASDPNLGKRLAAIGYADVADLDTDLVEMYLDDILVAEHGGRAASYTEAQGQAVMSKD 371 A FASDPN G+ LAA+G A V + D D +++YL D+L+ E+GGRA SYTE GQAVM++ Sbjct: 307 ALFASDPNWGRILAAVGRAGVENFDIDAIQIYLGDVLLVENGGRADSYTEEAGQAVMNET 366 Query: 372 EITVRIKLHRGQAAATVYTCDLSHGYVSINADYRS 406 +I ++I L+RG+A V+T D S+ YV INA+YR+ Sbjct: 367 DINIKIILNRGEAGEVVWTTDFSYDYVKINAEYRT 401 Lambda K H 0.317 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 401 Length adjustment: 31 Effective length of query: 375 Effective length of database: 370 Effective search space: 138750 Effective search space used: 138750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory