Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate WP_024850736.1 N745_RS0103410 inositol monophosphatase
Query= curated2:P56160 (259 letters) >NCBI__GCF_000526715.1:WP_024850736.1 Length = 266 Score = 112 bits (280), Expect = 8e-30 Identities = 79/259 (30%), Positives = 126/259 (48%), Gaps = 6/259 (2%) Query: 1 MTPDLQLALELAEKAGKLTLDYFGR-RSLQVFSKRDDTPVTEADRNAEELIRQGISAKFP 59 M P L +A A++AG + L + K + V+E D+ AE++I I +P Sbjct: 1 MHPILNVASIAAKEAGNFIVSQIRNVEQLTIEEKGRNDYVSEIDKRAEQIIIDTIHKYYP 60 Query: 60 DDGLFGEEFDEHPSGNGRRWIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPAL 119 + EE H + WIIDP+DGT +F+HG P + V IA+ +G + GV+ P Sbjct: 61 QHSILAEESGAHKKDSDFEWIIDPLDGTTNFLHGFPQFSVSIAVTEKGRLMHGVVFDPTR 120 Query: 120 GELYQAERGSGAFMNGSPVQVS--AIAENS--ASTVVFTEKEYLLDPPSNHPVDQLRIDA 175 EL+ A RGSGA +N ++VS +N+ A+ + + + +++ D + L+ A Sbjct: 121 DELFSASRGSGARLNNYRIRVSEQKTLQNALLATGIPYYDFDHIDDYLACFKEFMLQ-TA 179 Query: 176 GLVRGWGDCYGHMLVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQSIIDGE 235 G+ R VA GR + + + PWD AA IV EAGG D G ++ Sbjct: 180 GIRRPGSAALDLAYVACGRVDGYWELNLKPWDIAAGALIVAEAGGLVSDMVGGGKFLESG 239 Query: 236 GLVSANNAMGRNLIAAIGN 254 +++AN M + + I N Sbjct: 240 NIIAANPKMMKAMAQVISN 258 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 266 Length adjustment: 25 Effective length of query: 234 Effective length of database: 241 Effective search space: 56394 Effective search space used: 56394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory