Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate WP_025272347.1 HALAL_RS0101720 cystathionine gamma-synthase
Query= reanno::Korea:Ga0059261_3194 (402 letters) >NCBI__GCF_000527155.1:WP_025272347.1 Length = 380 Score = 191 bits (486), Expect = 2e-53 Identities = 131/337 (38%), Positives = 182/337 (54%), Gaps = 19/337 (5%) Query: 65 YSRLQNPTVEMLEQRIALLEGAEACRATASGMAAMTAALLCQLSAGDH-LIGGRAAFGSC 123 Y+RL NPTV E+ +A LE +EA A ASGMAAM+A+LL S G ++ R +G Sbjct: 60 YARLHNPTVARFEKALAELEHSEAAVAFASGMAAMSASLLAATSGGKREIVAVRPVYGGT 119 Query: 124 RWLTDTQLPKFGIETTVVDARDPQQFIDAIRPNTKVFFFETPANPTMDVVDLKAVCAIAR 183 + T L G E T DA DAI NT + ETPANPT+ + ++ + Sbjct: 120 DLVLSTGL--LGTEVTWTDA---DSVADAITSNTALVIVETPANPTLHELSIRDIATACG 174 Query: 184 ERGIVTVVDNAFATPALQRPMDFGADVVAYSATKMMDGQGRVLAGAVCGTEEFINNTLLP 243 + + +VDN ATPALQ P+ GA + +SATK + G G V+ G V E F + Sbjct: 175 D--VPLLVDNTLATPALQNPIREGASIALHSATKALGGYGDVVGGVVACDEAFAQK-MRS 231 Query: 244 FHRNTGPTLSPFNAWVVLKGLETLDLRIQRQSENALKVARFLEG--RVPRVNFPGLPSHP 301 TG L P A+++ +GL TL LR++R S A +A L+ RV V++PGL S+ Sbjct: 232 VRIATGGVLHPLAAYMLQRGLATLPLRVERMSRTAHDLAVRLQDDPRVSAVHYPGLNSNR 291 Query: 302 QHNLAMSQMAAAGPIFSIELDGGRTQAHGLLDALGLIDISNNIGDSRSLMTHPASTTHSG 361 SQM + G + S E A ++ + LI + ++G SL+ HPAS TH Sbjct: 292 P-----SQMTSGGTMVSFETT---EDARDVIKKVSLITPAVSLGSVDSLIQHPASLTHHV 343 Query: 362 VAEDQRLLMGVGEGMLRLNVGLEDPEDLIADLDQALG 398 V D R G+ + ++RL+VGLE P+DL ADLD ALG Sbjct: 344 VDPDARETCGISDHLIRLSVGLESPDDLWADLDTALG 380 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 380 Length adjustment: 31 Effective length of query: 371 Effective length of database: 349 Effective search space: 129479 Effective search space used: 129479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory