Align Phosphoserine phosphatase SerB1; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate WP_025273081.1 HALAL_RS0105715 HAD-IB family hydrolase
Query= SwissProt::P9WGJ3 (308 letters) >NCBI__GCF_000527155.1:WP_025273081.1 Length = 258 Score = 112 bits (281), Expect = 7e-30 Identities = 83/247 (33%), Positives = 118/247 (47%), Gaps = 6/247 (2%) Query: 57 AAAFFDVDNTLVQGSSAVHFGRGLAARHYFTYRDVLGFLYAQAKFQLLGKENSNDVAAGR 116 +AAFFD+D T+V SSA+ FGR L RDVL Y Q +++ G + + R Sbjct: 5 SAAFFDLDKTIVSKSSALAFGRPLYHLGLLGRRDVLRAAYGQLVYRI-GGGDGRQMERTR 63 Query: 117 RKALAFIEGRSVAELVALGEEIYDEIIADKIWDGTRELTQMHLDAGQQVWLITATPYELA 176 G S + + E D +I I+ +L + HLDAG+ V LI+A+ Y++ Sbjct: 64 NYLADLSRGWSAETVRDVVMETLDHLIQPFIYTEALDLVRGHLDAGRNVVLISASGYDIV 123 Query: 177 ATIARRLGLTGALGT-VAESVDGIFTGRLVGEILHGTGKAHAVRSLAIREGLNLKRCTAY 235 + IA LG+ + T + +G++TG V G KA A+R A ++L AY Sbjct: 124 SPIADSLGIPEVIATRLRTDGNGMYTGE-VEFYAAGQAKAEAIRDYARNRDIDLSASFAY 182 Query: 236 SDSYNDVPMLSLVGTAVAINPDARLRSLARERGWEIRDFRIARKAARIGVPSALALGAAG 295 SDS D PML VG +N D LR L + GW + F R G P + Sbjct: 183 SDSITDEPMLRAVGNPRVVNGDKSLRKLGKSEGWPLLSF---NDPTREGKPCGKEMRTGF 239 Query: 296 GALAALA 302 A+AALA Sbjct: 240 VAVAALA 246 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 258 Length adjustment: 26 Effective length of query: 282 Effective length of database: 232 Effective search space: 65424 Effective search space used: 65424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory