Align Carbamoyl-phosphate synthase small chain, chloroplastic; Carbamoyl-phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 (characterized)
to candidate WP_025274770.1 HALAL_RS0114940 glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit
Query= SwissProt::Q9LVW7 (430 letters) >NCBI__GCF_000527155.1:WP_025274770.1 Length = 394 Score = 278 bits (712), Expect = 2e-79 Identities = 160/394 (40%), Positives = 224/394 (56%), Gaps = 36/394 (9%) Query: 58 ARLVLEDGSIWPAKSFGAPGTRIAELVFNTSLTGYQEILTDPSYAGQFVLMTNPQIGNTG 117 A LVLEDG + +++GA G E VFNT++TGYQE LTDPSY GQ V+ T PQIGNTG Sbjct: 7 AILVLEDGRTFHGEAYGAVGETFGEGVFNTAMTGYQETLTDPSYHGQVVVQTAPQIGNTG 66 Query: 118 VNPDDEESGQCFLTGLVIRNLSISTSNWRCTKTLADYLTERDIMGVYDLDTRAITRRLRE 177 +N +D+ES + G VI + S SNWR T+ L D L ++ ++G+ +DTRA+TR LRE Sbjct: 67 INDEDDESDHIRVAGYVINDPSHIRSNWRSTRGLEDTLAQQGVVGICGVDTRALTRHLRE 126 Query: 178 DGSLIGVLSTEQSKTDDELLQMSRSWDIVGIDLISDVSCKSPYEWVDKTNAEWDFNTNSR 237 G++ +S+E + ++ S + G +L VD+ E + Sbjct: 127 HGAMRVGISSESTDVAALAERVRHSPGMEGANL------------VDRVTTEEKYVVGPD 174 Query: 238 DGKSYKVIAYDFGIKQNILRRLSSYGCQITVVPSTFPAAEALKMNPDGILFSNGPGDPSA 297 + Y V A D GIK+N RRL+ G + V P+ E L + PD + SNGPGDP+ Sbjct: 175 EPPRYTVAALDLGIKRNTPRRLAERGVETHVFPAHTGVDELLSVEPDAVFLSNGPGDPAT 234 Query: 298 VPYAVETVKELLGK-VPVYGICMGHQLLGQALGGKTFKMKFGHHGGNHPVRNNRTGQVEI 356 V T ELL + VPV+GIC G+Q+LG+ALG +TFK+ +GH G N PV + T +VE+ Sbjct: 235 AEVQVATTVELLRRGVPVFGICFGNQILGRALGLETFKLAYGHRGINQPVLDRHTEKVEV 294 Query: 357 SAQNHNYAV---DPASLPGG--------------------VEVTHVNLNDGSCAGLSFPE 393 +A NH +A+ D A+ GG VEV+HV LND GL+ + Sbjct: 295 TAHNHGFALRMPDAAATDGGEFDPTAHLGPTPTFQTEFGEVEVSHVCLNDNVVEGLTCRD 354 Query: 394 MNVMSLQYHPEASPGPHDSDNAFREFIELMKRSK 427 + S+QYHPEA+ GPHD+D F ++L+ K Sbjct: 355 VPAFSVQYHPEAAAGPHDADYLFDRLVQLIDTHK 388 Lambda K H 0.316 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 491 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 394 Length adjustment: 31 Effective length of query: 399 Effective length of database: 363 Effective search space: 144837 Effective search space used: 144837 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_025274770.1 HALAL_RS0114940 (glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.931435.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-134 433.9 0.0 1.3e-133 431.4 0.0 1.8 1 NCBI__GCF_000527155.1:WP_025274770.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000527155.1:WP_025274770.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 431.4 0.0 1.3e-133 1.3e-133 1 360 [. 7 385 .. 7 386 .. 0.97 Alignments for each domain: == domain 1 score: 431.4 bits; conditional E-value: 1.3e-133 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskkikv 73 a+lvledG++f+g+++ga +e++Ge vFnT+mtGYqE+ltDpsY+gq+vv t+p+ign+g+n+ed es++i v NCBI__GCF_000527155.1:WP_025274770.1 7 AILVLEDGRTFHGEAYGAVGETFGEGVFNTAMTGYQETLTDPSYHGQVVVQTAPQIGNTGINDEDDESDHIRV 79 68*********************************************************************** PP TIGR01368 74 kglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeelvekakesp 146 +g v+++ s+ sn+r+++ Le+ l+++g+v+i gvDTRal+++lRe+g+m+ is+e+++ l+e++++sp NCBI__GCF_000527155.1:WP_025274770.1 80 AGYVINDPSHIRSNWRSTRGLEDTLAQQGVVGICGVDTRALTRHLREHGAMRVGISSESTDVAALAERVRHSP 152 ************************************************************************* PP TIGR01368 147 kvkevnlvkevstkeayeleqkakkegkklrvvvidlGvKenilreLvkrgvevtvvpadtsaeeikklnpdg 219 ++++nlv++v+t+e+y + e +++v+++dlG+K+n+ r+L++rgve++v+pa+t ++e+ +++pd+ NCBI__GCF_000527155.1:WP_025274770.1 153 GMEGANLVDRVTTEEKYVVGP---DEPPRYTVAALDLGIKRNTPRRLAERGVETHVFPAHTGVDELLSVEPDA 222 *****************9996...4566699****************************************** PP TIGR01368 220 illsnGPGdPaaveeaietvkklleakiPifGIclGhqllalalgaktyklkfGhrGaNhpvkdlktgrveit 292 ++lsnGPGdPa++e +++t+ +ll + +P+fGIc+G+q+l++alg +t+kl +GhrG N+pv d +t++ve+t NCBI__GCF_000527155.1:WP_025274770.1 223 VFLSNGPGDPATAEVQVATTVELLRRGVPVFGICFGNQILGRALGLETFKLAYGHRGINQPVLDRHTEKVEVT 295 ************************************************************************* PP TIGR01368 293 sqNHgyavdees......................lkeeelevthvnlnDgtveglehkelpvfsvQyHPeasp 343 ++NHg+a+ ++ +e+ev hv+lnD+ vegl+ +++p+fsvQyHPea++ NCBI__GCF_000527155.1:WP_025274770.1 296 AHNHGFALRMPDaaatdggefdptahlgptptfqTEFGEVEVSHVCLNDNVVEGLTCRDVPAFSVQYHPEAAA 368 *******975434678999**********999888899*********************************** PP TIGR01368 344 GphdteylFdefvelik 360 Gphd++ylFd++v+li+ NCBI__GCF_000527155.1:WP_025274770.1 369 GPHDADYLFDRLVQLID 385 *************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (394 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.28 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory