Align LL-diaminopimelate aminotransferase (EC 2.6.1.83) (characterized)
to candidate WP_026329666.1 F612_RS0106445 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::O66630 (387 letters) >NCBI__GCF_000381085.1:WP_026329666.1 Length = 393 Score = 175 bits (443), Expect = 2e-48 Identities = 118/391 (30%), Positives = 191/391 (48%), Gaps = 13/391 (3%) Query: 1 MFEFSDRLKVLPPYLFAELDRKKQEKIEQGVDVIDLGVGDPDMPTPKPIVEAAKKALENP 60 M SDR+ + P L + K E G D+I LG G+PD TP+ I A A++N Sbjct: 1 MASLSDRVNRVKPSLTLVITAKAAELKRAGKDIISLGAGEPDFDTPQHIKAAGITAIQNG 60 Query: 61 ENHKYPSYVGKYEFRKAVADWYKRRFDVDLDPNTEVITLIGSKEGIAHFPLAFVNPGDIV 120 + +Y + G E ++A+ +KR ++ N +++ G K+ + A +N GD V Sbjct: 61 QT-RYTAVDGTPELKEAIQAKFKRDNGLEYAMN-QILVSSGGKQSFFNLCQAILNDGDEV 118 Query: 121 LCPDPAYPVYRIGAIFAGGTPYTVPLKEENNFLPDLDSIPEDVAKKAKIIWINYPNNPTS 180 + P P + Y A+ AGG P + E F + E + K KI+ +N P+NPT Sbjct: 119 IIPAPYWVSYPDMALLAGGEPVIIEAGIEQGFKITATQLEEAITPKTKIMVVNSPSNPTG 178 Query: 181 APPTLEFYKKLVDWAKEY-NVIIASDNAYSEIYTGQEKPPSILQV-PGAKDVAIEFHSLS 238 A T + K L D +Y N+IIASD+ Y I +IL+V P + + + +S Sbjct: 179 AVYTADELKSLADVLVKYPNIIIASDDMYEHIMISDMPFTNILEVCPELTERTVVMNGVS 238 Query: 239 KTYNMTGWRIGMAVGNKELVAGLGKVKTNVDSGQFGAVQDAGIVALNLPEEEVEKIRDVY 298 K Y+MTGWRIG A G E++ G+ KV++ S Q A + ALN +E ++ + + Sbjct: 239 KAYSMTGWRIGYAAGPAEIITGMRKVQSQSTSNPCSISQAAAVAALNGSQECIQTMLVEF 298 Query: 299 RERKKIMTEALEKI-GLEIYRSDYTFYLWIKVPEGY------TSAEFVGRLIDEAGIVCT 351 ++R + E + +I G + + FY ++ V + T + L++E + Sbjct: 299 KKRHTFVVERINQIPGFKCIEAHGAFYAFMDVSQALTMKNMATDTDLTTALLEEKLVAVV 358 Query: 352 PGNGFGEYGEGYFRISLTVPTERLLEAAERI 382 PG+ FG + + RIS E L+ A +RI Sbjct: 359 PGSAFG--ADKHLRISFATSMENLVNALDRI 387 Lambda K H 0.317 0.139 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 393 Length adjustment: 31 Effective length of query: 356 Effective length of database: 362 Effective search space: 128872 Effective search space used: 128872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory