Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate WP_026595516.1 A3OQ_RS0105180 aspartate aminotransferase family protein
Query= BRENDA::Q93R93 (395 letters) >NCBI__GCF_000385335.1:WP_026595516.1 Length = 455 Score = 212 bits (539), Expect = 2e-59 Identities = 140/393 (35%), Positives = 218/393 (55%), Gaps = 32/393 (8%) Query: 34 GQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRGEFY 93 G+G +WD +G+ Y+D + G+GV LG +P V +A+K + + + P+ Sbjct: 37 GRGQYLWDRKGDRYLDLLSGWGVFGLGRNHPTVRDALKTVLDADLPGLVQMDLPLLAGLL 96 Query: 94 RTLTAILPPELNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGRTMGSLSVTWE 153 P L++VF NSG+EA E+A+KFAR TGR V F G + G+L++ + Sbjct: 97 AERLLRYVPYLDKVFFANSGSEAVESAIKFARRATGRSGIVYCDHAFHGLSYGALALNGD 156 Query: 154 PKYREPFLPLVEPVEFIPYNDVEALKRAV-DEETAAVILEPVQGEGGVRPATPEFLRAAR 212 +RE F PL+ IP+ND+ AL++A+ + A I+EP+QG+ GV +LR A+ Sbjct: 157 NTFREGFGPLLPDCHEIPFNDLAALEKALRTRQIAGFIVEPIQGK-GVNMPDDLYLRGAQ 215 Query: 213 EITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGG-VPLGVAVMR--- 268 + ++ G L I DEIQTGMGRTG+ A EH+ + PD++ LAK L GG VP+G + R Sbjct: 216 ALCRKYGTLFIADEIQTGMGRTGRFLAVEHWNVEPDMVLLAKTLSGGHVPVGAVLTRKAV 275 Query: 269 -EEVARSMPKG-GHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRA-IP 325 ++V M K HG+TF N LAMAAG+A + +E+ RL + AA+ G + A +P Sbjct: 276 FDKVFTRMDKAVVHGSTFAKNDLAMAAGLATLEVIEQERLIQNAAKTGARLLAAFEAMVP 335 Query: 326 SPK-IREVRGMGLMVGLE------LKEKAAPYIAR--------------LEKEHRVLALQ 364 + ++ VRG GLM+G+E LK KA+ + L K+H++LA Sbjct: 336 RYELLKAVRGKGLMIGIEFGPPKSLKLKASWTLLEAANAGLFCQLITVPLFKDHKILAQV 395 Query: 365 AGPTV--IRFLPPLVIEKEDLERVVEAVRAVLA 395 AG + I+ LP +++ D + + ++ V+A Sbjct: 396 AGHGIHTIKLLPAMILTDTDCDWIEQSFEQVIA 428 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 455 Length adjustment: 32 Effective length of query: 363 Effective length of database: 423 Effective search space: 153549 Effective search space used: 153549 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory