Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (characterized)
to candidate WP_026595549.1 A3OQ_RS0106185 type III PLP-dependent enzyme
Query= SwissProt::B4XMC6 (405 letters) >NCBI__GCF_000385335.1:WP_026595549.1 Length = 376 Score = 107 bits (268), Expect = 4e-28 Identities = 110/373 (29%), Positives = 170/373 (45%), Gaps = 32/373 (8%) Query: 14 PFYLYDFDKIKQAFLNYKEAFKGRKSLICYALKANSNLSILSLLAHLESGADCVSIGEIQ 73 P + D D ++ + ++ +A + I YA+KAN + +LSLLA L S D S+ EI+ Sbjct: 17 PCMVLDLDVVRDNYFSFAKALPDTR--IFYAVKANPDPQVLSLLAELGSCFDTASVVEIE 74 Query: 74 RALKAGIKPYRIVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIETIAQSLGIKARIS 133 + L AG RI F K +I +A L + V+ E++ I +A +++ Sbjct: 75 QVLAAGASADRISFGNTIKKERDIARAYALGVRLFAVDCEAEVEKIARVAPG----SKVF 130 Query: 134 IRINPNIDAKTHPYISTGLKENKFGVGEKEALEMFLWAKKSAFLEPVSVHFHIGSQLLDL 193 RI + P KFG A + A S L + FH+GSQ D Sbjct: 131 CRILCDATGAEWPL------SRKFGCAPAMAPRVLEHAH-SLGLNAYGLSFHVGSQQRDP 183 Query: 194 EPIIEASQKVAKIAKSLIALGIDLRFFDVGGGIGVSY-ENEETIKLYDYAQGILNALQ-- 250 A + A+I + L GI L+ ++GGG Y N +K Y Q I +L+ Sbjct: 184 RMWDGALKAAAEIFRDLAERGISLQMVNLGGGFPTKYLRNVPAVKA--YGQSIFKSLRKH 241 Query: 251 ---GLDLTIICEPGRSIVAESGELITQ-VLYEKKAQNK--RFVIVDAG-MNDFLRPSLYH 303 + TII EPGR +V +G + + VL KK+ ++V +D G N + Sbjct: 242 FGNRIPETII-EPGRGMVGNAGIIEAEVVLISKKSDTDQVKWVYLDIGKFNGLAETTDEM 300 Query: 304 AKHAIRVITPSKGREISPCDVVGPVCESSDT-FLKDAHL--PELEPGDKIAIEKVGAYGS 360 ++ I+ +E PC + GP C+S D + KD +L LE G K+ IE GAY + Sbjct: 301 IRYPIKTAFDHDAKE--PCVLAGPSCDSVDVLYEKDPYLLPVSLEIGAKVLIEGTGAYTT 358 Query: 361 SMAS-QYNSRPKL 372 + +S +N P L Sbjct: 359 TYSSVGFNGFPPL 371 Lambda K H 0.319 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 376 Length adjustment: 31 Effective length of query: 374 Effective length of database: 345 Effective search space: 129030 Effective search space used: 129030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory