Align Indole-3-glycerol phosphate synthase; Short=IGPS; EC 4.1.1.48 (characterized, see rationale)
to candidate WP_026596383.1 H035_RS0107585 indole-3-glycerol phosphate synthase TrpC
Query= uniprot:A0A166NT80_PSEFL (278 letters) >NCBI__GCF_000421465.1:WP_026596383.1 Length = 267 Score = 290 bits (742), Expect = 2e-83 Identities = 154/264 (58%), Positives = 192/264 (72%), Gaps = 1/264 (0%) Query: 1 MSVPTVLENILARKVQEVAERSARVSLAELENLAKAADAPRGFAKALIDQAKTKQPAVIA 60 MS +L+ IL K +E+ R RV+L ++ +A++ AP F AL + ++ QPAVIA Sbjct: 1 MSQADILQKILTTKREEIDRRRRRVALGDVREMAESQAAPLDFRGALERRVESAQPAVIA 60 Query: 61 EIKKASPSKGVIRENFVPADIAKSYEKGGATCLSVLTDIDYFQGADAYLQQARAACKLPV 120 EIKKASPS+GVIRE F P +IA SY KGGA CLSVLTD YFQG++AYLQ A+ LP Sbjct: 61 EIKKASPSQGVIREAFDPREIALSYAKGGAACLSVLTDKPYFQGSEAYLQLAKQTAGLPT 120 Query: 121 IRKDFMIDPYQIVESRALGADCVLLIVSALDDVKMAELAAVAKSVGLDVLVEVHDGDELE 180 +RKDF +DPYQ+ E+RA+ AD +LLIV+ALDD M ++ +A+ + L VLVEVHDGDELE Sbjct: 121 LRKDFTVDPYQVYEARAIQADAILLIVAALDDALMRDMYQLARELSLAVLVEVHDGDELE 180 Query: 181 RALKTLDTPLVGVNNRNLHTFEVNLETTLDLLPRIPRDRLVITESGILNRADVELMEISD 240 RAL L+ ++G+NNRNL TFEV+LE TL+LLP IP RLV+TESGI R DV M Sbjct: 181 RAL-PLENAVLGINNRNLRTFEVSLENTLNLLPHIPEGRLVVTESGIHTREDVAKMRARG 239 Query: 241 VYAFLVGEAFMRAESPGTELQRLF 264 V+AFLVGEAFMRAE PG L RLF Sbjct: 240 VHAFLVGEAFMRAEDPGKALGRLF 263 Lambda K H 0.318 0.135 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 267 Length adjustment: 25 Effective length of query: 253 Effective length of database: 242 Effective search space: 61226 Effective search space used: 61226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory