Align amino-acid N-acetyltransferase (EC 2.3.1.1); acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate WP_026605792.1 METAC_RS0102300 acetylglutamate kinase
Query= BRENDA::Q0ASS9 (441 letters) >NCBI__GCF_000427445.1:WP_026605792.1 Length = 294 Score = 104 bits (259), Expect = 4e-27 Identities = 84/266 (31%), Positives = 126/266 (47%), Gaps = 16/266 (6%) Query: 38 ERFAVIKVGGAVIQDDLPG--LASALAFLQTVGLTPVVVHGGGPQLDAALEAADIPTERV 95 E V+K GG + DD G A + L+ G+ PVVVHGGGPQ+ A L I + Sbjct: 32 EAIVVVKYGGHAMGDDKVGRDFARDMVLLEQSGVNPVVVHGGGPQIGAMLAKLGIKSAFA 91 Query: 96 DGLRVTRDEAIPIIRDTLTQA-NLALVDAIRDAGGRAAAVPRGVFEADIVDADK------ 148 DGLR+T I I+ L + N +V I GGRA + + ++V A+K Sbjct: 92 DGLRITDRATIEIVEMVLAGSINKQIVGFINAEGGRAIGLCGK--DGNMVIANKAAPTSG 149 Query: 149 ---LGRVGEPRHIHLDLVGSAARAGQAAILACLGETPDGTLVNINADVAVRALVHALQPY 205 LG VGEP + ++ +LA + + DG N+NAD A+ AL+ Sbjct: 150 AIDLGFVGEPAKVDTTVLDQVLGRELIPVLAPIAQGVDGETYNVNADTFAGAIAGALKAK 209 Query: 206 KVVFLTGTGGLLDEDGDILSSINLATDFGDLMQADWVNGGMRLKLEE-IKRLLDDLPLSS 264 +++FLT G+LD++ D++ + + L+ + GGM K+E I L + Sbjct: 210 RLLFLTDVPGVLDKNKDLIKELRV-DQIHALIADGTITGGMIPKVETCIYALEQGVEGVV 268 Query: 265 SVSITRPSELARELFTHAGSGTLIRR 290 + P + EL T G+GTLI R Sbjct: 269 ILDGKTPHAVLVELLTDHGAGTLITR 294 Lambda K H 0.320 0.139 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 294 Length adjustment: 29 Effective length of query: 412 Effective length of database: 265 Effective search space: 109180 Effective search space used: 109180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory