Align Aspartate kinase; Aspartokinase; EC 2.7.2.4 (characterized)
to candidate WP_026607195.1 METAC_RS0111830 aspartate kinase
Query= SwissProt::Q88EI9 (411 letters) >NCBI__GCF_000427445.1:WP_026607195.1 Length = 412 Score = 399 bits (1024), Expect = e-115 Identities = 222/412 (53%), Positives = 292/412 (70%), Gaps = 10/412 (2%) Query: 1 MALIVQKFGGTSVGSIERIEQVAEKVKKHREAGDDLVVVLSAMSGETNRLIDLAKQITDQ 60 M+ +V KFGGTSV +IERI VA V++ R++G D+ VV+SAMSG+TN L+ + + Sbjct: 1 MSRLVMKFGGTSVANIERIRNVARHVERERKSGADVAVVVSAMSGKTNELVGWCAEASRL 60 Query: 61 PVPRELDVIVSTGEQVTIALLTMALIKRGVPAVSYTGNQVRILTDSSHNKARILQID-DQ 119 PRE D +V++GEQ+T LL + L GVPA S+ G Q+ ILT SH ARI I+ D Sbjct: 61 YDPREYDCVVASGEQITAGLLAIVLQDMGVPARSWQGWQIPILTSQSHGSARIAHINADA 120 Query: 120 KIRADLKEGRVVVVAGFQGVD-EHGSITTLGRGGSDTTGVALAAALKADECQIYTDVDGV 178 I G V VVAGFQG+ E G ITTLGRGGSDT+ VA+AAA+ AD C IYTDVDGV Sbjct: 121 IIEGFASRGEVAVVAGFQGLHKESGRITTLGRGGSDTSAVAVAAAIGADRCDIYTDVDGV 180 Query: 179 YTTDPRVVPQARRLEKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLHSFKE---- 234 YTTDPR+VP+A+RL++I FEEMLEMASLG+KVLQ+RSVE A + V V SF + Sbjct: 181 YTTDPRIVPKAKRLDRIAFEEMLEMASLGAKVLQVRSVELAMAHKVKTYVRSSFDDPLDP 240 Query: 235 GPGTLITIDEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISASNIEVDMI 294 GTLI DEE+ +EQ +++GIAF++DEA++T+R V D PGVA I P++ +NI VDMI Sbjct: 241 KAGTLI-CDEEDILEQQVVTGIAFSKDEAQITLRKVVDHPGVAAAIFMPLAEANINVDMI 299 Query: 295 VQNVAHDNT--TDFTFTVHRNEYEKAQSVLENTAREIGAREVIGDTKIAKVSIVGVGMRS 352 +Q VA +N+ TD TFTV ++E+A+S+L +IG + G ++ K+S +GVGMRS Sbjct: 300 IQ-VASENSGVTDMTFTVSTADFERAKSILHKLQPQIGFESLNGAMEVVKISAIGVGMRS 358 Query: 353 HAGVASCMFEALAKESINIQMISTSEIKVSVVLEEKYLELAVRALHTAFDLD 404 HAGVA+ F+ALA++ INI+ I+TSEIK SV++E Y ELAVR LHT + LD Sbjct: 359 HAGVAAMAFKALAEKGINIRAITTSEIKFSVLIEAAYTELAVRTLHTLYGLD 410 Lambda K H 0.316 0.133 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 396 Number of extensions: 12 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 411 Length of database: 412 Length adjustment: 31 Effective length of query: 380 Effective length of database: 381 Effective search space: 144780 Effective search space used: 144780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_026607195.1 METAC_RS0111830 (aspartate kinase)
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00656.hmm # target sequence database: /tmp/gapView.8207.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00656 [M=407] Accession: TIGR00656 Description: asp_kin_monofn: aspartate kinase, monofunctional class Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-128 413.4 7.5 6.1e-128 413.2 7.5 1.0 1 lcl|NCBI__GCF_000427445.1:WP_026607195.1 METAC_RS0111830 aspartate kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000427445.1:WP_026607195.1 METAC_RS0111830 aspartate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 413.2 7.5 6.1e-128 6.1e-128 4 404 .. 4 407 .. 1 410 [. 0.96 Alignments for each domain: == domain 1 score: 413.2 bits; conditional E-value: 6.1e-128 TIGR00656 4 iVqKFGGtsvgsserikkaakivlkelkegkkvvVVvSAmskvtdelvelaellklleaisdeisprer 72 V+KFGGtsv+++eri+++a++v +e k+g +v VVvSAms++t+elv + s pre lcl|NCBI__GCF_000427445.1:WP_026607195.1 4 LVMKFGGTSVANIERIRNVARHVERERKSGADVAVVVSAMSGKTNELVGWC------AEASRLYDPREY 66 69************************************************9......7889999***** PP TIGR00656 73 delvsvGEllssallssalrelgvkaealdgkeagilTddefgnAkikelateerLlelLeegiivvva 141 d +v+ GE++++ ll+ +l++ gv a++ +g++ +ilT++++g+A+i +++ + ++ +g + vva lcl|NCBI__GCF_000427445.1:WP_026607195.1 67 DCVVASGEQITAGLLAIVLQDMGVPARSWQGWQIPILTSQSHGSARIAHINADAIIEGFASRGEVAVVA 135 ****************************************************999999999******** PP TIGR00656 142 GFiGat.eeGeiTtLGRGGSDltAallaaalkAdrveiyTDVeGvyttDPrvveeakkidkisyeEale 209 GF+G e G+iTtLGRGGSD++A+++aaa+ Adr++iyTDV+GvyttDPr+v++ak++d+i++eE+le lcl|NCBI__GCF_000427445.1:WP_026607195.1 136 GFQGLHkESGRITTLGRGGSDTSAVAVAAAIGADRCDIYTDVDGVYTTDPRIVPKAKRLDRIAFEEMLE 204 ****75167************************************************************ PP TIGR00656 210 lAtlGakvlhpralelaveakvpilvrsske....keegTlitn..kkensslvkaialeknvarltve 272 +A+lGakvl+ r++ela++ kv+ vrss++ +++gTli++ + ++++v++ia++k+ a++t++ lcl|NCBI__GCF_000427445.1:WP_026607195.1 205 MASLGAKVLQVRSVELAMAHKVKTYVRSSFDdpldPKAGTLICDeeDILEQQVVTGIAFSKDEAQITLR 273 *****************************963332579*****955344457***************** PP TIGR00656 273 gegmlgkrgilaeifkaLaeeeinvdlisqtese....tsislvvdeedvdeakkaLkeesgaaelesl 337 ++++++g++a if Lae++invd+i+q se t+++++v++ d ++ak++L++ + ++++esl lcl|NCBI__GCF_000427445.1:WP_026607195.1 274 --KVVDHPGVAAAIFMPLAEANINVDMIIQVASEnsgvTDMTFTVSTADFERAKSILHKLQPQIGFESL 340 ..*******************************999999****************************** PP TIGR00656 338 eveedlavvsivgaglveapGvaseifkaleekninilmisssetkisvlvdekdaekavrklhekl 404 + ++ ++s++g+g++++ Gva+ +fkal+ek+ini i++se+k svl++ +++e avr+lh + lcl|NCBI__GCF_000427445.1:WP_026607195.1 341 NGAMEVVKISAIGVGMRSHAGVAAMAFKALAEKGINIRAITTSEIKFSVLIEAAYTELAVRTLHTLY 407 ****************************************************************866 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (407 nodes) Target sequences: 1 (412 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.61 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory