Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate WP_026607432.1 METAC_RS0113360 glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >NCBI__GCF_000427445.1:WP_026607432.1 Length = 400 Score = 384 bits (985), Expect = e-111 Identities = 205/382 (53%), Positives = 250/382 (65%), Gaps = 14/382 (3%) Query: 4 SALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNV 63 +ALLVL +G G GA G AVGEV FNT+MTGYQEILTDPSY+ QIVT T+PHIGNV Sbjct: 18 TALLVLANGLVHEGFGQGAVGEAVGEVCFNTAMTGYQEILTDPSYAGQIVTFTFPHIGNV 77 Query: 64 GTNDADEESSQVHA----QGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLT 119 G ND D E+S + A +G + SN R T+ L ++LK I+ + +DTR LT Sbjct: 78 GVNDEDVETSNLAAPEGVRGAIFYAPITEPSNHRATQSLGAWLKARGIIGLYGLDTRALT 137 Query: 120 RLLREKGAQNGCIIAGDNPDAALALE----KARAFPGLNGMDLAKEVTTAEAYSWTQGSW 175 +R+ G N I +PD +E KAR +PGL GMDL VT E Y WT+ +W Sbjct: 138 TYIRDNGMPNAVI--AHSPDGVFDIERLRAKARQWPGLEGMDLVPGVTAPERYGWTEAAW 195 Query: 176 TLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDG 235 T G A F VVA D+G KRNILR+L D GC +T+VPA TSAE + + PDG Sbjct: 196 TPDHGYRAAGAGK---FKVVAIDYGVKRNILRLLADAGCEVTVVPATTSAEAIEGLRPDG 252 Query: 236 IFLSNGPGDPAPCD-YAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGN 294 +FLSNGPGDPA YA+ I+ LE+ IP FGICLGHQ+L LA GAKT KM+ GHHG N Sbjct: 253 VFLSNGPGDPAETGKYAVPVIRTLLESKIPTFGICLGHQMLGLAIGAKTKKMRQGHHGAN 312 Query: 295 HPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHP 354 HPVKD V I + NHGFAVD A+LPAN R TH+SLFDG+ G+ TD+PAFS Q HP Sbjct: 313 HPVKDFTTGKVEIVSMNHGFAVDPASLPANARETHRSLFDGSNCGLELTDRPAFSVQHHP 372 Query: 355 EASPGPHDAAPLFDHFIELIEQ 376 EASPGP D+ LF F+E++E+ Sbjct: 373 EASPGPRDSHYLFRRFVEMMEK 394 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 488 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 400 Length adjustment: 31 Effective length of query: 351 Effective length of database: 369 Effective search space: 129519 Effective search space used: 129519 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_026607432.1 METAC_RS0113360 (glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.1181384.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-132 427.7 0.0 2e-132 427.5 0.0 1.0 1 NCBI__GCF_000427445.1:WP_026607432.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000427445.1:WP_026607432.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 427.5 0.0 2e-132 2e-132 1 361 [] 19 394 .. 19 394 .. 0.94 Alignments for each domain: == domain 1 score: 427.5 bits; conditional E-value: 2e-132 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskkik. 72 a lvl++G v eg + ga +e+vGev+FnT+mtGYqEiltDpsY+gqiv++t p+ign+gvn+ed+e ++ NCBI__GCF_000427445.1:WP_026607432.1 19 ALLVLANGLVHEGFGQGAVGEAVGEVCFNTAMTGYQEILTDPSYAGQIVTFTFPHIGNVGVNDEDVETSNLAa 91 579***************************************************************9886542 PP TIGR01368 73 ...vkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistekse...keelv 139 v+g + +e+sn+ra++sL ++lk +gi++++g+DTRal+ +R++g +avi+++ e+l NCBI__GCF_000427445.1:WP_026607432.1 92 pegVRGAIFYAPITEPSNHRATQSLGAWLKARGIIGLYGLDTRALTTYIRDNGMPNAVIAHSPDGvfdIERLR 164 33389*******************************************************9987666689999 PP TIGR01368 140 ekakespkvkevnlvkevstkeayeleq.....k...akkegkklrvvvidlGvKenilreLvkrgvevtvvp 204 +ka++ p +++++lv v++ e+y +++ + + + k +vv+id+GvK+nilr L++ g+evtvvp NCBI__GCF_000427445.1:WP_026607432.1 165 AKARQWPGLEGMDLVPGVTAPERYGWTEaawtpDhgyRAAGAGKFKVVAIDYGVKRNILRLLADAGCEVTVVP 237 99*************************966655156444555559**************************** PP TIGR01368 205 adtsaeeikklnpdgillsnGPGdPaav.eeaietvkklleakiPifGIclGhqllalalgaktyklkfGhrG 276 a+tsae+i+ l+pdg++lsnGPGdPa+ ++a+ +++lle+kiP+fGIclGhq+l+la+gakt k++ Gh+G NCBI__GCF_000427445.1:WP_026607432.1 238 ATTSAEAIEGLRPDGVFLSNGPGDPAETgKYAVPVIRTLLESKIPTFGICLGHQMLGLAIGAKTKKMRQGHHG 310 *************************7763778999************************************** PP TIGR01368 277 aNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdte 349 aNhpvkd++tg+vei s NHg+avd++sl+++ ++ th++l+Dg++ gle ++ p+fsvQ+HPeaspGp+d++ NCBI__GCF_000427445.1:WP_026607432.1 311 ANHPVKDFTTGKVEIVSMNHGFAVDPASLPAN-ARETHRSLFDGSNCGLELTDRPAFSVQHHPEASPGPRDSH 382 ****************************9866.99************************************** PP TIGR01368 350 ylFdefvelikk 361 ylF++fve+++k NCBI__GCF_000427445.1:WP_026607432.1 383 YLFRRFVEMMEK 394 *********985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (400 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 15.30 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory