Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_026608290.1 METAC_RS0119415 cystathionine beta-lyase
Query= metacyc::HP_RS00540-MONOMER (380 letters) >NCBI__GCF_000427445.1:WP_026608290.1 Length = 395 Score = 202 bits (515), Expect = 1e-56 Identities = 137/386 (35%), Positives = 205/386 (53%), Gaps = 13/386 (3%) Query: 1 MRMQTKLIHGGISEDATTGAVSVPIYQTSTYR----QDAIGRHKGYEYSRSGNPTRFALE 56 ++ +T+LIH G G V+ PIY+ ST D R+ + Y G PT ALE Sbjct: 12 LKAKTRLIHAGRRPSEQFGFVNTPIYRGSTVLFPTLDDLTRRNAKFSYGTQGTPTTEALE 71 Query: 57 ELIADLEGGVKGFAFASGLAGIH-AVFSLLQSGDHVLLGDDVYGGTFRLFNQVLVKNGLS 115 +L G SGLA I A+ + +++GDH+L+ D Y T + +L + G+ Sbjct: 72 TAWTELSGAAGTVLVPSGLAAISLALLTAVKAGDHILVTDSAYRPTRIFCDGILARMGVE 131 Query: 116 CTIIDTSDISQIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIVDNTFAT 175 T D + I+ I+ NT ++LE P + ++ D+ A VA+ G+ TI+DNT+AT Sbjct: 132 TTYYDPWIGAGIEALIRANTSVIFLEAPGSQSFEMQDVPAIAKVARAKGVCTILDNTWAT 191 Query: 176 PYYQNPLLLGADIVAHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAIGGVLGPQDS 235 P + P G D+ +GTKYL GHSD++ GLV+ N + L + A F +A GP+D Sbjct: 192 PIFFPPHERGVDMAIEAGTKYLSGHSDLLLGLVSANAQWLNRLRATF-DAFAMCPGPEDV 250 Query: 236 WLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQMRGFSG 295 +L RG++TL LR+ ++ L +A +L + +V V +P LP+ P + L K+ G SG Sbjct: 251 FLALRGLRTLDLRLREAERQGLALATWLAERDEVAVVLHPALPSCPGHALWKRDFLGSSG 310 Query: 296 MLSFTLKNDSEA--VAFVESLKLFILGESLGGVESLVGIPAFMTHACIPKTQREAAGIRD 353 + S L+ S A A ++ LKLF +G S GG ESLV IP F TQ G Sbjct: 311 LFSVILRPCSTAALAAMLDGLKLFGMGFSWGGFESLV-IP-FDCRVYRTATQWSPPG--- 365 Query: 354 GLVRLSVGIEHEQDLLEDLEQAFAKI 379 +R SVG+E +DL DL + F ++ Sbjct: 366 PALRFSVGLEDIEDLKADLAEGFERL 391 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 395 Length adjustment: 30 Effective length of query: 350 Effective length of database: 365 Effective search space: 127750 Effective search space used: 127750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory