Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (uncharacterized)
to candidate WP_026608471.1 METAC_RS0120605 type III PLP-dependent enzyme
Query= curated2:P19572 (415 letters) >NCBI__GCF_000427445.1:WP_026608471.1 Length = 376 Score = 110 bits (275), Expect = 7e-29 Identities = 111/370 (30%), Positives = 162/370 (43%), Gaps = 45/370 (12%) Query: 28 PTYVYSRAHIEAQYRAYADALAGMPHLVCFAVKANSNLGVLNVLARLGAGFDIVSRGELE 87 P V + Y A+A AL V +AVKAN + VL +LA LG+ FD S E+E Sbjct: 17 PCLVVDLEVVRDNYAAFARALPDTR--VFYAVKANPDPRVLELLAALGSCFDTASVVEIE 74 Query: 88 RVLAAGGDPAKVVFSGVGKTRDDMRRALEVGVHCFNVESGEELERLQRVAAELGVKAPVS 147 + LAAG P ++ F K D+ RA +GV F V+ E+E++ R A + V Sbjct: 75 QALAAGASPDRISFGNTIKKERDIARAYALGVRLFAVDCEAEVEKIARAAP----GSKVF 130 Query: 148 LRVNPDVDAQTHPYISTGLKENKFGIAIDEAEAVYARAAELDHLEVIGVDCHIGSQLTQL 207 R+ P KFG A++ A V A L L G+ H+GSQ Q Sbjct: 131 CRMLCGGAGAEWPL------SRKFGCAVEMAPRVLEHAHRLG-LVAFGLSFHVGSQ--QR 181 Query: 208 EPFL--DALERLLGLVDRLAGKGIGIRHLDLGGGLGVRYRDEQPPLAGDYIRAIRERLH- 264 P++ AL+ + LA +GI ++ ++LGGG RY P + Y +AI LH Sbjct: 182 NPYMWDAALKASAAIFRDLADRGIVLQMVNLGGGFPTRYLKSVPAVKA-YAQAILRSLHK 240 Query: 265 --GRDL-TLVFEPGRSIVANAGVLLTRVEYLKHTEHKD-----------FAIVDAAMNDL 310 G + + EPGR +V NAGV+ V + D F + M+++ Sbjct: 241 HFGNHIPETIIEPGRGMVGNAGVIEAEVVLISRKSDDDEVKWVYLDIGKFNGLAETMDEM 300 Query: 311 IRPALYQAWMDVQAVRPRDAAPRRYDLVGPICETGDFLAKDR----DLALAEGDLLAVRS 366 IR + A+ D P L GP C++ D L + ++L G + + Sbjct: 301 IRYPIRTAF-DGDETAP-------CVLAGPSCDSVDVLYEKEPYFLPISLEIGSKVLIEG 352 Query: 367 AGAYGFVMSS 376 GAY SS Sbjct: 353 TGAYTTTYSS 362 Lambda K H 0.321 0.139 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 415 Length of database: 376 Length adjustment: 31 Effective length of query: 384 Effective length of database: 345 Effective search space: 132480 Effective search space used: 132480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory