Align chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_027177480.1 G496_RS0100125 cytochrome c4
Query= reanno::Pedo557:CA265_RS11635 (379 letters) >NCBI__GCF_000429985.1:WP_027177480.1 Length = 363 Score = 355 bits (912), Expect = e-103 Identities = 176/360 (48%), Positives = 247/360 (68%), Gaps = 1/360 (0%) Query: 1 MKLNLNIQSLNTWLNVNNEPLIISGPCSAETEEQLLTTAHLLAATGKVSVLRAGIWKPRT 60 M ++L+I + W + PLII+GPCSAE+ EQ+L TA +A +G +LRAGIWKPRT Sbjct: 1 MSVDLDITPIKDWGFEFDGPLIIAGPCSAESREQVLETAKGVAKSG-AHMLRAGIWKPRT 59 Query: 61 RPGEFEGIGSIGLEWLKRAKAETGLPTAVEVANAKHVEEALAAGVDILWIGARSTVNPFT 120 RP FEG+G GL+WL A+ TG+P +VE AN +HVE L VD++W+GAR+TVNPF Sbjct: 60 RPNCFEGMGEEGLKWLVEAREVTGMPISVETANPEHVELCLKYNVDLIWVGARTTVNPFA 119 Query: 121 VQEIADALKGHDVPVLIKNPVNPDLQLWIGAIERINGAGITKIGAIHRGFSSFEKSSFRN 180 VQ +AD+L+G D+PVL+KNP+NPD++LWIGA+ER+N AG+TK+GAIHRGFSS + +RN Sbjct: 120 VQALADSLEGSDIPVLVKNPINPDVELWIGALERLNKAGVTKLGAIHRGFSSARATEYRN 179 Query: 181 EPMWELAIQLKTLCPELPIINDPSHICGNRELIPYISQKALDLDMQGLMIESHVDPSVAW 240 P W + I+L+ C +PII DPSH+CG R LIP ++QKALDL GLMIESH++P VA Sbjct: 180 APNWRIFIELRRRCEGMPIICDPSHLCGKRALIPAVAQKALDLLFDGLMIESHINPDVAL 239 Query: 241 TDAKQQVTPAALAELVDRLTVREPEAPNEAFADKLADLRKSIDKIDDVLLQKLGERMAIV 300 +D+KQQ TP LA+++ L R P A +E F + R + +IDD ++ L ERM + Sbjct: 240 SDSKQQFTPDDLAKVIADLKPRNPAATDENFILSIEKERIRLGEIDDQIVDLLDERMQLS 299 Query: 301 EKIGEFKRDNQVTILQVNRWDAIIKKGHAFAKALKLDLNFTEKFLELVHGESIRKQTEIM 360 IGE KR + +LQ +W ++ A+ +D +F + + +H ES+R+Q +I+ Sbjct: 300 RHIGELKRSRGLALLQPAQWKKTAERRVEEAEKRGMDAHFMLRVFQYIHEESLRQQEDII 359 Lambda K H 0.317 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 363 Length adjustment: 30 Effective length of query: 349 Effective length of database: 333 Effective search space: 116217 Effective search space used: 116217 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory