Align 3-phosphoshikimate 1-carboxyvinyltransferase; EC 2.5.1.19 (characterized, see rationale)
to candidate WP_027177589.1 G496_RS0100780 3-phosphoshikimate 1-carboxyvinyltransferase
Query= uniprot:Q72EV5_DESVH (439 letters) >NCBI__GCF_000429985.1:WP_027177589.1 Length = 445 Score = 440 bits (1132), Expect = e-128 Identities = 224/435 (51%), Positives = 282/435 (64%), Gaps = 4/435 (0%) Query: 4 VVVTAPPSKSLSHRALIGAALAAGESTVEHVLESRDLTCTADILRAAGAHIERRAPGSYL 63 + + P SKSLSHRALI A++ + V LES D+ T D L GA IE + Sbjct: 7 IQIKVPSSKSLSHRALIAGAMSQDTTVVLEPLESNDINRTMDCLTTMGAEIEINGSAT-T 65 Query: 64 VRGVAGTPAGGFEAPVSCDVHESGTTCRLLTAVLAAGMGRFRIHGAPRMHERPIGELTDA 123 V+G A P GG P ++ +SGTTCRL+TAV AAG G FR+ G PRMH+RPI LT A Sbjct: 66 VKGFASGPKGGLSEPAILEMRDSGTTCRLITAVAAAGKGLFRVQGTPRMHQRPISALTAA 125 Query: 124 LASLGVQIAFEARAGFPPLVIDAAGMRGGEVSIGMDESSQYLSGLLLAAPLT-QGMTVNV 182 + S G+ + F R G+PP+ I+ G GG V I +++SSQYLSGLLLAAPL + M +NV Sbjct: 126 IRSQGINVTFAGRQGYPPMTIETRGFSGGIVDISLEDSSQYLSGLLLAAPLAREEMVINV 185 Query: 183 AGKSVVSWPYVGLTLQTLEDFGIDFTVETRDAVDAPWGAVDWRSLHEAVPGLVRFRVRPG 242 G+ VSWPYV LTL+ +E F + F+VE D W DW+ + VPG +RFRV+P Sbjct: 186 IGRKAVSWPYVALTLEVMEGFRVPFSVEILK--DGKWEKADWKKITRVVPGEIRFRVQPS 243 Query: 243 MYRAGSYRVEGDWSGASYFLAAGAVGPRPVRVEGLRVDSLQGDRALLDILTAMGADIRPG 302 Y ++VE DWS ASYF AAGAVG +PV ++G+ VDS+QGDRA+LDIL MGA I Sbjct: 244 KYNCEEFKVEADWSSASYFAAAGAVGRKPVMIKGVSVDSMQGDRAILDILKKMGAYIEYD 303 Query: 303 EGHVVVHPAPLHGVEVDMGHCPDLVPTVAAVAAFATGRTVVRNVAHLRIKESDRIAAPVG 362 + VHP+ LHGVEVDMG CPDLVPTV A AAFA G TV++NVAHLRIKE DR+ A Sbjct: 304 NHGITVHPSKLHGVEVDMGLCPDLVPTVCATAAFAEGPTVIKNVAHLRIKECDRLEASAN 363 Query: 363 ELRRAGVNAEERADGLVVQGGALATEPGTLFSAHGDHRMAMSLALLGLGGVDVRLDDPSC 422 E+ RAG AE D + V G +FS + DHR+AMS A+ GL G+ +DP C Sbjct: 364 EVIRAGGKAEVYKDSIKVMPGKFRKGEKIVFSTYDDHRLAMSTAIYGLAGIKAVAEDPGC 423 Query: 423 VSKSFPHFWELWEKV 437 V+KSFP FW+ W+KV Sbjct: 424 VAKSFPGFWDEWKKV 438 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 533 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 445 Length adjustment: 32 Effective length of query: 407 Effective length of database: 413 Effective search space: 168091 Effective search space used: 168091 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_027177589.1 G496_RS0100780 (3-phosphoshikimate 1-carboxyvinyltransferase)
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.26250.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-116 374.3 0.1 5.3e-115 370.5 0.1 1.9 1 lcl|NCBI__GCF_000429985.1:WP_027177589.1 G496_RS0100780 3-phosphoshikimat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429985.1:WP_027177589.1 G496_RS0100780 3-phosphoshikimate 1-carboxyvinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 370.5 0.1 5.3e-115 5.3e-115 2 413 .. 8 439 .. 7 441 .. 0.91 Alignments for each domain: == domain 1 score: 370.5 bits; conditional E-value: 5.3e-115 TIGR01356 2 eikipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakveeekeelviegvgglkepe 70 +ik+p+sKS+shRal+++a+++ +tvv ++L+s+D++ t+++l +Ga++e ++ ++++g++ p+ lcl|NCBI__GCF_000429985.1:WP_027177589.1 8 QIKVPSSKSLSHRALIAGAMSQDTTVVLEPLESNDINRTMDCLTTMGAEIEINGSATTVKGFAS--GPK 74 69*************************************************8899******874..444 PP TIGR01356 71 ......aeldlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgaeieskeeegslP 133 a+l++++sGtt Rl+t+v+a+ +g + ++g +++++RPi l+ a r+ g+++ + ++g++P lcl|NCBI__GCF_000429985.1:WP_027177589.1 75 gglsepAILEMRDSGTTCRLITAVAAAGKGLFRVQGTPRMHQRPISALTAAIRSQGINVTFAGRQGYPP 143 4567778************************************************************** PP TIGR01356 134 laisgp.lkggivelsgsaSsQyksalllaaplalqavtleivgeklisrpyieitLkllksfgvevee 201 ++i+ +ggiv +s + SsQy+s+lllaapla ++ ++++g k +s py+ +tL++++ f v +++ lcl|NCBI__GCF_000429985.1:WP_027177589.1 144 MTIETRgFSGGIVDISLEDSSQYLSGLLLAAPLAREEMVINVIGRKAVSWPYVALTLEVMEGFRVPFSV 212 *****98899***************************************************99876554 PP TIGR01356 202 e....de..............r..kivvkggqkykqkevevegDaSsAafflaaaaitgeevtvenlge 250 e + +++v++ ky+++e++ve+D SsA++f+aa+a+ + v ++++ lcl|NCBI__GCF_000429985.1:WP_027177589.1 213 EilkdGKwekadwkkitrvvpGeiRFRVQP-SKYNCEEFKVEADWSSASYFAAAGAVGRKPVMIKGVSV 280 322212244344533222222111233443.3599********************************** PP TIGR01356 251 nstqgdkaiiivLeemGadveveeqrdvevegasklkgvkvdidvdsliDelptlavlaafAegetrik 319 +s qgd+ai+++L++mGa +e++++ ++v+ +skl+gv+ +d+ ++D++pt+ + aafAeg+t+ik lcl|NCBI__GCF_000429985.1:WP_027177589.1 281 DSMQGDRAILDILKKMGAYIEYDNH-GITVH-PSKLHGVE--VDMGLCPDLVPTVCATAAFAEGPTVIK 345 *************************.7***9.899*****..*************************** PP TIGR01356 320 nieelRvkEsdRiaaiaeeLeklGveveeledgllieGkk.kelkgavvdtydDHRiamalavlglaae 387 n+++lR+kE+dR++a a+e + G ++e+ +d++++ ++k ++ ++ v +tydDHR+am++a+ gla lcl|NCBI__GCF_000429985.1:WP_027177589.1 346 NVAHLRIKECDRLEASANEVIRAGGKAEVYKDSIKVMPGKfRKGEKIVFSTYDDHRLAMSTAIYGLAGI 414 ***************************************9989999*********************98 PP TIGR01356 388 geveiedaecvaksfPeFfevleqlg 413 + ed++cvaksfP F++ ++++ lcl|NCBI__GCF_000429985.1:WP_027177589.1 415 -KAVAEDPGCVAKSFPGFWDEWKKVL 439 .8889*****************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (445 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.06u 0.00s 00:00:00.06 Elapsed: 00:00:00.06 # Mc/sec: 2.82 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory