Align N-(5'-phosphoribosyl)anthranilate isomerase; PRAI; EC 5.3.1.24 (uncharacterized)
to candidate WP_027177595.1 G496_RS0100810 phosphoribosylanthranilate isomerase
Query= curated2:C6C1D3 (205 letters) >NCBI__GCF_000429985.1:WP_027177595.1 Length = 205 Score = 265 bits (677), Expect = 4e-76 Identities = 119/200 (59%), Positives = 153/200 (76%) Query: 1 MSLLVKVCGMTSKEDATMCEQLGVDFLGFIFHPSSPRNVDAAFARSVKTDGAKKVGVFVK 60 M +VKVCGMT ++DA +CE LG LGFIFHP SPRNV FA S+KT A+K GVFVK Sbjct: 1 MKPVVKVCGMTREQDAALCETLGASLLGFIFHPGSPRNVSVDFAASIKTATARKTGVFVK 60 Query: 61 QSATEVIETLKNGQLDFAQLHGGQNEEFCKAVGKERVIKVLWPQKYDSVKEFQADIDRFV 120 QSA+EV++ + L +AQLHGGQN EFCKA+G +RVIKVLWPQKY+SV + Q +IDRF Sbjct: 61 QSASEVLKIMSMAGLHYAQLHGGQNVEFCKAIGPDRVIKVLWPQKYESVIQLQTEIDRFA 120 Query: 121 PHCTYLLFDAGKSGGGHGIAMEFEVFKDVTIPVPWLLAGGLSAENLREALDTAQPNGVDL 180 PHC YLLFDAGKSGGGHG +++ +F + IP W +AGG++ +N+ + L+ +P+GVD+ Sbjct: 121 PHCRYLLFDAGKSGGGHGTSLDLNIFTKINIPCEWFIAGGINPDNICQVLEAVEPDGVDI 180 Query: 181 NSGVESEPGKKERNKLAAAF 200 NSGVE+EPG K++NKL F Sbjct: 181 NSGVEAEPGIKDKNKLQTVF 200 Lambda K H 0.318 0.135 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 205 Length adjustment: 21 Effective length of query: 184 Effective length of database: 184 Effective search space: 33856 Effective search space used: 33856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory