Align Chorismate mutase; CM; Monofunctional chorismate mutase AroQ(f); EC 5.4.99.5 (characterized)
to candidate WP_027178547.1 G496_RS0106375 5-enolpyruvylshikimate-3-phosphate synthase
Query= SwissProt::Q57696 (99 letters) >NCBI__GCF_000429985.1:WP_027178547.1 Length = 547 Score = 50.1 bits (118), Expect = 3e-11 Identities = 21/67 (31%), Positives = 41/67 (61%) Query: 10 KKIDEIDNKILKLIAERNSLAKDVAEIKNQLGIPINDPEREKYIYDRIRKLCKEHNVDEN 69 ++I EID+K+L +++ RN L A + Q G+P+ DPE E+ ++++ +L H+ + Sbjct: 22 QEIQEIDSKLLSMLSRRNLLMGKAASKRRQKGLPLADPEMERRLFEKWNELSTSHSFESK 81 Query: 70 IGIKIFQ 76 +IF+ Sbjct: 82 SSRRIFE 88 Lambda K H 0.315 0.136 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 117 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 99 Length of database: 547 Length adjustment: 22 Effective length of query: 77 Effective length of database: 525 Effective search space: 40425 Effective search space used: 40425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 46 (22.3 bits)
Align candidate WP_027178547.1 G496_RS0106375 (5-enolpyruvylshikimate-3-phosphate synthase)
to HMM PF01817 (CM_2)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF01817.25.hmm # target sequence database: /tmp/gapView.17204.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.9e-14 37.9 0.1 2.3e-13 36.7 0.1 1.5 1 lcl|NCBI__GCF_000429985.1:WP_027178547.1 G496_RS0106375 5-enolpyruvylshik Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429985.1:WP_027178547.1 G496_RS0106375 5-enolpyruvylshikimate-3-phosphate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.7 0.1 2.3e-13 2.3e-13 2 71 .. 22 91 .. 22 96 .. 0.96 Alignments for each domain: == domain 1 score: 36.7 bits; conditional E-value: 2.3e-13 CM_2 2 keIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreii 71 +eI+eiD++ll +l++R l+ ++a ++++glp dpe e+ ++e++ e +++ ++ + ++if+++ lcl|NCBI__GCF_000429985.1:WP_027178547.1 22 QEIQEIDSKLLSMLSRRNLLMGKAASKRRQKGLPLADPEMERRLFEKWNELSTSHSFESKSSRRIFEQVN 91 69************************************************999**************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (79 nodes) Target sequences: 1 (547 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 13.57 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory