Align Methionine synthase component, methyltransferase domain (EC:2.1.1.13) (characterized)
to candidate WP_027178998.1 G496_RS0109010 methionine synthase
Query= reanno::Phaeo:GFF1321 (338 letters) >NCBI__GCF_000429985.1:WP_027178998.1 Length = 804 Score = 142 bits (359), Expect = 2e-38 Identities = 89/278 (32%), Positives = 152/278 (54%), Gaps = 11/278 (3%) Query: 18 DGATGTNLFNMGLQSGDAPELWNVDEPKKITALYQGAVDAGSDLFLTNTFGGTAARLKLH 77 DG GT L GL +G +PEL+ +++P+ + ++++ +AG+++ TNTFGG+A +L Sbjct: 17 DGGYGTFLQKRGLPAGMSPELFGLEKPEVVRSVHEDYANAGANVLTTNTFGGSAPKL--- 73 Query: 78 DAHRRVRELNVAGAELGRNVADRSERKIAVAGSVGPTGEIMQPVGELSHALAVEMFHEQA 137 + + R+LN A L R+VA + + VAGSVGPTG ++P+G+ + VE++ EQ Sbjct: 74 GSKVKARDLNREMALLARSVAGDN---LFVAGSVGPTGHFIEPLGDFTFKEMVEIYKEQI 130 Query: 138 EALKEGGVDVLWLETISAPEEYRA-AAEAFKLADMPWCGTMSFDTAGRTMMGVTSADMAQ 196 + L +GGVD++ ET E RA A ++ +P +M+F++ + G + Sbjct: 131 QGLVDGGVDLILGETHFDLAEARALVVAAREVCALPVALSMTFESPNACLTGSSPQTFVD 190 Query: 197 LVEEFDPAPLAFGANCGTGASDILRTVLGFAAQGTTRPIISKGNAGIPKYVDG-HIHYDG 255 ++ + G NC G I + + +T P++ + NAG+P+ + + + Sbjct: 191 AMQNMEID--IVGTNCSAGPEQIFEVISNMRPRLST-PLLVEANAGLPELDENRNTVFRL 247 Query: 256 TPTLMGEYAAMARDCGAKIIGGCCGTMPDHLRAMREAL 293 P E +A GAK IGGCCGT PDH+RA++ + Sbjct: 248 EPQPFAEQSARFLAIGAKFIGGCCGTGPDHIRALKSVI 285 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 650 Number of extensions: 36 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 804 Length adjustment: 35 Effective length of query: 303 Effective length of database: 769 Effective search space: 233007 Effective search space used: 233007 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory