Align Homocysteine formation from aspartate semialdehyde (NIL/ferredoxin component) (characterized)
to candidate WP_027179535.1 G496_RS0112220 4Fe-4S dicluster domain-containing protein
Query= reanno::Miya:8499492 (147 letters) >NCBI__GCF_000429985.1:WP_027179535.1 Length = 147 Score = 170 bits (430), Expect = 1e-47 Identities = 74/134 (55%), Positives = 106/134 (79%) Query: 11 KNIHLTFPPEISGKPIVSDLVRRYDLTVNILKAQITPRKEGYLTLEISGGEDNCLKGIAY 70 K IHL FPPEISG+P++ +L + +DL+ NILK+ I PR+EG +TLEISG E+ GI Y Sbjct: 9 KIIHLAFPPEISGRPVICNLGKLFDLSFNILKSDINPRQEGSMTLEISGTEEEFQTGINY 68 Query: 71 LREQDVTVTDVSQRISRDEDSCMHCGMCTAICPTSALAMDIEARVVVFDKDRCTACGLCT 130 L+E V++ V+ +I+RDEDSCMHCGMC A+CPT AL++D++ R+V+FD ++CTACG CT Sbjct: 69 LKENGVSLIPVASKIARDEDSCMHCGMCLAMCPTGALSLDMDTRLVMFDLEKCTACGRCT 128 Query: 131 RVCPVGAMNVEVEN 144 ++CPV AM ++ ++ Sbjct: 129 KICPVRAMIIDPQD 142 Lambda K H 0.321 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 126 Number of extensions: 3 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 147 Length of database: 147 Length adjustment: 16 Effective length of query: 131 Effective length of database: 131 Effective search space: 17161 Effective search space used: 17161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory