Align aspartate semialdehyde dehydrogenase subunit (EC 1.2.1.11) (characterized)
to candidate WP_027180548.1 G496_RS0118270 aspartate-semialdehyde dehydrogenase
Query= metacyc::MONOMER-6564 (346 letters) >NCBI__GCF_000429985.1:WP_027180548.1 Length = 342 Score = 357 bits (916), Expect = e-103 Identities = 183/340 (53%), Positives = 243/340 (71%), Gaps = 8/340 (2%) Query: 7 VAVVGATGAVGQQMLKTLEDRNFEMDTLTLLSSKRSAGTKVTFKGQELTVQEASPESFEG 66 VAVVGATGAVG++ML LE RNF + +S RS G K+ F G+ELTV E +SF+G Sbjct: 8 VAVVGATGAVGREMLSILEQRNFPASEIVPFASSRSVGIKLPFAGEELTVVELKEDSFKG 67 Query: 67 VNIALFSAGGSVSQALAPEAVKRGAIVIDNTSAFRMDENTPLVVPEVNEADLHEHNGIIA 126 ++ALFSAGG S AP A ++G +V+DN+SA+RMD PLVVPEVN DL H+GIIA Sbjct: 68 FDLALFSAGGGTSTKFAPLAAEQGCVVVDNSSAWRMDPKKPLVVPEVNPQDLDWHDGIIA 127 Query: 127 NPNCSTIQMVAALEPIRKAYGLNKVIVSTYQAVSGAGNEAVKELYSQTQAILNKEEIEPE 186 NPNCSTIQMV AL+PI KA + +++VSTYQAVSG+G +A+ EL +Q + N + I P+ Sbjct: 128 NPNCSTIQMVVALQPIHKAAKIKRIVVSTYQAVSGSGQKAINELETQVSRLFNGKSIVPD 187 Query: 187 IMPVKGDKKHYQIAFNAIPQIDKFQDNGYTFEEMKMINETKKIMHMPDLQVAATCVRLPI 246 + P +QIAFN +PQID F DNGYT EEMKM+NET KIM ++V AT VR+P+ Sbjct: 188 VYP-------HQIAFNCLPQIDVFLDNGYTKEEMKMVNETVKIMGDESIKVTATTVRVPV 240 Query: 247 QTGHSESVYIEIDRDDATVEDIKNLLKEAPGVTLQDDPSQQLYPMPADAVGKNDVFVGRI 306 HSE+V IE ++ T E+ +N+L APG+T+ D P + LYPM +A G++DVFVGRI Sbjct: 241 FYAHSEAVNIETEK-KLTPEECRNILAGAPGITVADYPEKSLYPMAIEATGEDDVFVGRI 299 Query: 307 RKDLDRANGFHLWVVSDNLLKGAAWNSVQIAESLKKLNLV 346 R+D NG ++W+VSDN+ KGAA N++QIAE+L + +L+ Sbjct: 300 REDFTVDNGLNMWIVSDNIRKGAALNTIQIAETLIERDLL 339 Lambda K H 0.314 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 342 Length adjustment: 29 Effective length of query: 317 Effective length of database: 313 Effective search space: 99221 Effective search space used: 99221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
Align candidate WP_027180548.1 G496_RS0118270 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.691886.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-147 475.3 0.2 5.8e-147 475.1 0.2 1.0 1 NCBI__GCF_000429985.1:WP_027180548.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000429985.1:WP_027180548.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 475.1 0.2 5.8e-147 5.8e-147 1 338 [. 7 335 .. 7 336 .. 0.99 Alignments for each domain: == domain 1 score: 475.1 bits; conditional E-value: 5.8e-147 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsaGgsv 73 +va+vGatGavG+e+l +Le+rnfp++++v++as+rs G k+ f g+el+v e+++ sf+g d+alfsaGg + NCBI__GCF_000429985.1:WP_027180548.1 7 RVAVVGATGAVGREMLSILEQRNFPASEIVPFASSRSVGIKLPFAGEELTVVELKEDSFKGFDLALFSAGGGT 79 69*********************************************************************** PP TIGR01296 74 skefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkplkdeaklk 146 s +fap aa++g++v+Dn+sa+r+d++ PLvvpevn ++l + giianPnCstiq+vv+L+p++++ak+k NCBI__GCF_000429985.1:WP_027180548.1 80 STKFAPLAAEQGCVVVDNSSAWRMDPKKPLVVPEVNPQDLDWHD--GIIANPNCSTIQMVVALQPIHKAAKIK 150 ****************************************9999..*************************** PP TIGR01296 147 rvvvstYqavsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidklkedGytkeelkl 219 r+vvstYqavsG+G+k+++eL+ q+ ++gk + p + +++qiafn +p+id + ++Gytkee+k+ NCBI__GCF_000429985.1:WP_027180548.1 151 RIVVSTYQAVSGSGQKAINELETQVSRLFNGKSIVP-------DVYPHQIAFNCLPQIDVFLDNGYTKEEMKM 216 ******************************999986.......99**************************** PP TIGR01296 220 lfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvviddpsenlyptPleav 292 ++et ki+g+e +kv+at+vrvPvf++hse+v+ie+ek+l++ee +++L +apg++v d p++ lyp+ +ea+ NCBI__GCF_000429985.1:WP_027180548.1 217 VNETVKIMGDESIKVTATTVRVPVFYAHSEAVNIETEKKLTPEECRNILAGAPGITVADYPEKSLYPMAIEAT 289 ************************************************************************* PP TIGR01296 293 gkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaellik 338 g+d+vfvgrir+D + ++gl++++v+Dn+rkGaaln++qiae+li+ NCBI__GCF_000429985.1:WP_027180548.1 290 GEDDVFVGRIREDFTVDNGLNMWIVSDNIRKGAALNTIQIAETLIE 335 *******************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (342 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 24.87 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory