Align Probable aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.78; Transaminase A (uncharacterized)
to candidate WP_027456455.1 K420_RS0101285 pyridoxal phosphate-dependent aminotransferase
Query= curated2:O67781 (394 letters) >NCBI__GCF_000519045.1:WP_027456455.1 Length = 387 Score = 220 bits (560), Expect = 6e-62 Identities = 138/385 (35%), Positives = 203/385 (52%), Gaps = 12/385 (3%) Query: 6 ASRVSHLKPSPTLTITAKAKELRAKGVDVIGFGAGEPDFDTPDFIKEACIRALREGKTKY 65 A R++ ++P + + +A++L A+G D+I GEPDF TP+ I EA I A++ GKT Y Sbjct: 6 ARRLADIEPFHVVELLTRARQLEAEGRDIIHMEVGEPDFPTPEPIAEAAIAAIQRGKTLY 65 Query: 66 APSAGIPELREAIAEKLLKENKVEYKPSEIVVSAGAKMVLFLIFMAILDEGDEVLLPSPY 125 + G+PELR AIA+ + V S I ++ GA L L F A+ + GDE LL P Sbjct: 66 TQALGLPELRAAIADFYRERYGVVVPASRIAITNGASGALNLAFAALANPGDEWLLADPG 125 Query: 126 WVTYPEQIRFFGGVPVEVPLKKEKGFQLSLEDVKEKVTERTKAIVINSPNNPTGAVYEEE 185 + +R + GVP +P+ E FQ + +++ TE+T +++ SP NPTG + Sbjct: 126 YPCNRHILRTYEGVPRSIPVGPESNFQPTPAMLRQHWTEQTAGLLVASPANPTGTLLTLA 185 Query: 186 ELKKIAEFCVERGIFIISDECYEYFVYGDAKFVSPASFSDEVKNITFTVNAFSKSYSMTG 245 E++ +A C E+G + DE Y Y + + A+ D + +N+FSK + MTG Sbjct: 186 EIEALAAVCREKGGHFMVDEIYHGLTYEISAPTACAAGDD-----IWVINSFSKYFQMTG 240 Query: 246 WRIGYVACPEEYAKVIASLNSQSVSNVTTFAQYGALEALKNPKSKDFVNEMRNAFERRRD 305 WR+G++ PE Y + I L V +T AQY AL A + P + D + R F RRRD Sbjct: 241 WRLGWLVVPEAYGRDIEKLAQNLVLCPSTPAQYAALAAFE-PHTIDILEARRAEFRRRRD 299 Query: 306 TAVEELSKIPGMDVVKPEGAFYIFPDFSAYAEKLGGDVKLSEFLLEKAKVAVVPGSAFGA 365 L I +PEGAFY++ D SA A+ L+ LLEKA VA PG FG+ Sbjct: 300 FLAPALEAIGFRITARPEGAFYLYCDCSALAD---DSFMLARDLLEKAGVAATPGLDFGS 356 Query: 366 PG---FLRLSYALSEERLVEGIRRI 387 +R +Y RL E I R+ Sbjct: 357 NAPEKHIRFAYTTGIPRLAEAIERL 381 Lambda K H 0.317 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 387 Length adjustment: 31 Effective length of query: 363 Effective length of database: 356 Effective search space: 129228 Effective search space used: 129228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory