Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate WP_027456776.1 K420_RS0103165 diaminopimelate decarboxylase
Query= BRENDA::Q9KVL7 (417 letters) >NCBI__GCF_000519045.1:WP_027456776.1 Length = 420 Score = 490 bits (1261), Expect = e-143 Identities = 245/415 (59%), Positives = 314/415 (75%), Gaps = 6/415 (1%) Query: 8 EDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPH----LICYAVKAN 63 ++G L E V L+ +A ++GTP YVYSRA L F + +P L+CYAVKAN Sbjct: 7 KNGVLHVESVALSAIAERFGTPAYVYSRAALTASLREFQDVLTAHPAGQDALVCYAVKAN 66 Query: 64 SNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKIKCF 123 SNL +LN ARLG+GFDIVS GEL+RVLAAG DP KVVFSGVGKT AEMK AL I CF Sbjct: 67 SNLAILNLFARLGAGFDIVSGGELQRVLAAGADPKKVVFSGVGKTAAEMKLALDAGIFCF 126 Query: 124 NVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAAQVY 183 N+ES PEL+RLN+VAG+ G +APISLR+NP+VD KTHPYISTGL++ KFG+ ++ A +Y Sbjct: 127 NIESIPELERLNEVAGQCGKQAPISLRVNPNVDPKTHPYISTGLKEAKFGVAYEHALDLY 186 Query: 184 RLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGGLGV 243 R A +LP++ V GIDCHIGSQL +PF++A +R+LALID L EGI + H+D+GGGLG+ Sbjct: 187 RRAAALPHIAVAGIDCHIGSQLLDPSPFVEALERILALIDQLADEGITLHHIDLGGGLGI 246 Query: 244 VYR-DELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEHKNF 302 Y+ +++ P + Y LLD+L+ R L+++ EPGR + NAG+L+T++EFLK E KNF Sbjct: 247 KYKAEQVQPTVASYLNPLLDKLQ-GRGLQVVLEPGRRLVGNAGLLLTRIEFLKEGEGKNF 305 Query: 303 AIIDAAMNDLIRPALYQAWQDIIPLRPRQGEAQTYDLVGPVCETSDFLGKDRDLVLQEGD 362 AIIDAAMNDL+RPALY+AW DI P+ PR G + YD+VGPVCET DFLG+ R L +Q GD Sbjct: 306 AIIDAAMNDLMRPALYEAWHDIEPVEPRDGATRDYDVVGPVCETGDFLGQARPLCVQPGD 365 Query: 363 LLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALESVLPE 417 LLAV S+GAYG M+SNYNTRPR EVMVDG+ +++RQRE + L+A ES+LP+ Sbjct: 366 LLAVMSAGAYGMAMASNYNTRPRAVEVMVDGDAVHVIRQRETVEQLYAGESILPQ 420 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 504 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 420 Length adjustment: 32 Effective length of query: 385 Effective length of database: 388 Effective search space: 149380 Effective search space used: 149380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_027456776.1 K420_RS0103165 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.11717.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-160 518.4 0.0 6.3e-160 518.1 0.0 1.0 1 lcl|NCBI__GCF_000519045.1:WP_027456776.1 K420_RS0103165 diaminopimelate d Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000519045.1:WP_027456776.1 K420_RS0103165 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 518.1 0.0 6.3e-160 6.3e-160 5 416 .. 7 415 .. 4 416 .. 0.97 Alignments for each domain: == domain 1 score: 518.1 bits; conditional E-value: 6.3e-160 TIGR01048 5 kdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafka....eeslvlYAvKAnsnlavlrll 69 k+g l +e v+l ++ae+fgtP Yvy++++l++ l++++ + +a +++lv+YAvKAnsnla+l+l+ lcl|NCBI__GCF_000519045.1:WP_027456776.1 7 KNGVLHVESVALSAIAERFGTPAYVYSRAALTASLREFQDVLTAhpagQDALVCYAVKANSNLAILNLF 75 7899***********************************999885543445****************** PP TIGR01048 70 aeeGlgldvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakel 138 a++G+g+d+vsgGEl+r+laAg++++k+vfsg+gk+ +e++ al+++i ++n++s+ ele+l+e+a++ lcl|NCBI__GCF_000519045.1:WP_027456776.1 76 ARLGAGFDIVSGGELQRVLAAGADPKKVVFSGVGKTAAEMKLALDAGIFCFNIESIPELERLNEVAGQC 144 ********************************************************************* PP TIGR01048 139 gkkarvllRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlep 207 gk+a+++lRvnp+vd+kth+yisTGlke KFG+++e+a++ y++a++l+++ + Gi++HIGSq+ld +p lcl|NCBI__GCF_000519045.1:WP_027456776.1 145 GKQAPISLRVNPNVDPKTHPYISTGLKEAKFGVAYEHALDLYRRAAALPHIAVAGIDCHIGSQLLDPSP 213 ********************************************************************* PP TIGR01048 208 fveaaekvvklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekeaelglklklil 276 fvea+e+++ l+++l++egi+l+++dlGGGlgi+y+ e+ +p++++y + ll+kl++ + l+++l lcl|NCBI__GCF_000519045.1:WP_027456776.1 214 FVEALERILALIDQLADEGITLHHIDLGGGLGIKYKAEQVQPTVASYLNPLLDKLQG-----RGLQVVL 277 *******************************************************99.....699**** PP TIGR01048 277 EpGRslvanagvlltrVesvKevesrkfvlvDagmndliRpalYeayheiaalkrleeeetetvdvvGp 345 EpGR lv+nag lltr+e++Ke e ++f+++Da+mndl+RpalYea+h+i ++ + ++ +t +dvvGp lcl|NCBI__GCF_000519045.1:WP_027456776.1 278 EPGRRLVGNAGLLLTRIEFLKEGEGKNFAIIDAAMNDLMRPALYEAWHDIEPV-EPRDGATRDYDVVGP 345 *****************************************************.779999********* PP TIGR01048 346 lCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledlla 414 +CE+gD+l++ r l +v++Gdllav+saGAYg++m+snYn+rpr+ ev+v+++ +++ir+ret+e+l a lcl|NCBI__GCF_000519045.1:WP_027456776.1 346 VCETGDFLGQARPL-CVQPGDLLAVMSAGAYGMAMASNYNTRPRAVEVMVDGDAVHVIRQRETVEQLYA 413 *************9.6899***********************************************998 PP TIGR01048 415 le 416 e lcl|NCBI__GCF_000519045.1:WP_027456776.1 414 GE 415 66 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (420 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.34 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory