Align Phosphoserine aminotransferase; Phosphohydroxythreonine aminotransferase; PSAT; EC 2.6.1.52 (characterized)
to candidate WP_027457906.1 K420_RS0109840 aminotransferase class V-fold PLP-dependent enzyme
Query= SwissProt::Q59196 (362 letters) >NCBI__GCF_000519045.1:WP_027457906.1 Length = 352 Score = 253 bits (646), Expect = 5e-72 Identities = 143/358 (39%), Positives = 196/358 (54%), Gaps = 14/358 (3%) Query: 5 AYNFNAGPAALPLEVLERAQAEFVDYQHTGMSIMEMSHRGAVYEAVHNEAQARLLALLGN 64 A+NF AGPA LP VL RA+ G + E GA + A+ A +L AL+ Sbjct: 3 AWNFAAGPARLPDAVLARAERSLFARDAGGACLNEQPFSGAAFRALRAHATRQLAALINL 62 Query: 65 PTGYKVLFIQGGASTQFAMIPMNFLKEGQTANYVMTGSWASKALKEAKLIGDTHVAASSE 124 P Y++LF+ GGA QF+++P+N GQ YV TG W+++A EA L Sbjct: 63 PDDYRILFLAGGAMQQFSLLPLNLAAPGQRVGYVDTGYWSARAASEAALHRPV------- 115 Query: 125 ASNYMTLPKLQE--IQLQDNAAYLHLTSNETIEGAQFKAFPDT-GSVPLIGDMSSDILSR 181 +TLP E + + D+ AY HLT+NET +G + P VPL+ D ++D L R Sbjct: 116 ----LTLPPPGEAGLAVPDDLAYCHLTTNETADGLAWPELPAAPAGVPLVADATADFLCR 171 Query: 182 PFDLNQFGLVYAGAQKNLGPSGVTVVIVREDLVAESPKHLPTMLRYDTYVKNNSLYNTPP 241 P D+ +FGL+YA AQKN+G +G+ VVI REDL+A SP LP + Y + S NTPP Sbjct: 172 PLDMGRFGLLYASAQKNIGVAGLAVVIAREDLLARSPASLPGIWSYARQAEAESGVNTPP 231 Query: 242 SFGIYMVNEVLKWIEERGGLEGVQQANRKKASLIYDAIDQSGGFYRGCVDVDSRSDMNIT 301 + + V W+ +GGL + ANR+KA+L+Y AID SGGFYR D RS + + Sbjct: 232 ILALQLAALVFDWVAGQGGLPAMAAANRRKAALLYGAIDASGGFYRCPADSAWRSPVTVC 291 Query: 302 FRLASEELEKEFVKASEQEGFVGLKGHRSVGGLRASIYNAVPYESCEALVQFMEHFKR 359 ++L L F+ + G L GH GG+RAS+YNA+P AL FM F R Sbjct: 292 WQLPDAALTGRFISEAAAAGLHHLAGHPRRGGIRASLYNAMPEAGAAALASFMADFAR 349 Lambda K H 0.316 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 352 Length adjustment: 29 Effective length of query: 333 Effective length of database: 323 Effective search space: 107559 Effective search space used: 107559 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory