Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_027458324.1 K420_RS0112295 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::P00888 (356 letters) >NCBI__GCF_000519045.1:WP_027458324.1 Length = 357 Score = 369 bits (946), Expect = e-107 Identities = 181/352 (51%), Positives = 240/352 (68%), Gaps = 1/352 (0%) Query: 6 LNNVHITDEQVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSIH 65 L N++++ + TP ++ A P+S + ++ R + I+ +D RL VV GPCSIH Sbjct: 6 LENINVSAFDSMPTPAEIHAKLPISDKAARTVSHGRNLLRKILDRKDHRLFVVVGPCSIH 65 Query: 66 DPETALEYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGLQ 125 DP L+YA R K LA EV D+L ++MRVYFEKPRTTVGWKG INDP MD SF V G++ Sbjct: 66 DPVAGLDYAHRLKKLADEVGDTLQIIMRVYFEKPRTTVGWKGYINDPFMDDSFQVNVGME 125 Query: 126 IARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPVG 185 AR+ LL++ +GLP TEALDP PQY GDL +W+AIGARTTESQTHREM+SGLS PVG Sbjct: 126 KAREFLLQVNEIGLPAGTEALDPYGPQYYGDLIAWTAIGARTTESQTHREMSSGLSTPVG 185 Query: 186 FKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGGKA-PNYSP 244 FKN T G L A NA+ +A++PH F+G+N G+VA+++T GNP GH++LRGG++ PNY Sbjct: 186 FKNATSGDLTVATNAILSASRPHSFLGLNNEGRVAIVRTTGNPHGHIVLRGGESGPNYDT 245 Query: 245 ADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIES 304 +A E + +A L +++VDCSH NS+K QP V VV QI+ GN+SI+G+MIES Sbjct: 246 VSIAMAEAAIAKAKLPANIVVDCSHANSSKKPELQPLVMADVVNQIRAGNKSILGVMIES 305 Query: 305 NIHEGNQSSEQPRSEMKYGVSVTDACISWEMTDALLREIHQDLNGQLTARVA 356 NI GNQ ++KYG SVTD CI WE T+ +R+ L L R++ Sbjct: 306 NIEAGNQPIPADLKQLKYGCSVTDGCIGWETTEKTIRDAAVLLRDVLPERLS 357 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 357 Length adjustment: 29 Effective length of query: 327 Effective length of database: 328 Effective search space: 107256 Effective search space used: 107256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_027458324.1 K420_RS0112295 (3-deoxy-7-phosphoheptulonate synthase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.29435.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-145 468.0 0.0 8.7e-145 467.7 0.0 1.0 1 lcl|NCBI__GCF_000519045.1:WP_027458324.1 K420_RS0112295 3-deoxy-7-phospho Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000519045.1:WP_027458324.1 K420_RS0112295 3-deoxy-7-phosphoheptulonate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 467.7 0.0 8.7e-145 8.7e-145 2 335 .. 8 345 .. 7 351 .. 0.98 Alignments for each domain: == domain 1 score: 467.7 bits; conditional E-value: 8.7e-145 TIGR00034 2 dlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakr 70 ++++ ++d++ tP+e++ak p++ kaa +v + r+ + +il+ kd+rl+vv+GPcsihdp a l+ya+r lcl|NCBI__GCF_000519045.1:WP_027458324.1 8 NINVSAFDSMPTPAEIHAKLPISDKAARTVSHGRNLLRKILDRKDHRLFVVVGPCSIHDPVAGLDYAHR 76 788999*************************************************************** PP TIGR00034 71 lkklaeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatel 139 lkkla+++ d l+i+mrvyfekPrttvGWkG indP +++sf+vn G++ ar++ll+++e+glp++te+ lcl|NCBI__GCF_000519045.1:WP_027458324.1 77 LKKLADEVGDTLQIIMRVYFEKPRTTVGWKGYINDPFMDDSFQVNVGMEKAREFLLQVNEIGLPAGTEA 145 ********************************************************************* PP TIGR00034 140 ldtispqyladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvt 208 ld+ pqy++dl++w+aiGarttesq+hre++sgls pvgfkn+t G+l va +ai +a+++h fl+ + lcl|NCBI__GCF_000519045.1:WP_027458324.1 146 LDPYGPQYYGDLIAWTAIGARTTESQTHREMSSGLSTPVGFKNATSGDLTVATNAILSASRPHSFLGLN 214 ********************************************************************* PP TIGR00034 209 kaGqvaivetkGnedghiilrGGkk.pnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlev 276 ++G+vaiv+t+Gn++ghi+lrGG++ pnyd+ ++a +++ + ka+l +++++d+sh+ns+k+ + q+ v lcl|NCBI__GCF_000519045.1:WP_027458324.1 215 NEGRVAIVRTTGNPHGHIVLRGGESgPNYDTVSIAMAEAAIAKAKLPANIVVDCSHANSSKKPELQPLV 283 ********************************************************************* PP TIGR00034 277 aesvveqiaeGekaiiGvmiesnleeGnqsl...keelkyGksvtdacigwedteallrkla 335 +++vv+qi+ G+k+i+Gvmiesn+e Gnq + ++lkyG+svtd cigwe+te+ +r+ a lcl|NCBI__GCF_000519045.1:WP_027458324.1 284 MADVVNQIRAGNKSILGVMIESNIEAGNQPIpadLKQLKYGCSVTDGCIGWETTEKTIRDAA 345 ******************************965457899*****************999765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (357 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.45 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory