Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate WP_027720575.1 H589_RS0102535 aspartate carbamoyltransferase catalytic subunit
Query= curated2:Q7V8G9 (318 letters) >NCBI__GCF_000425265.1:WP_027720575.1 Length = 308 Score = 88.6 bits (218), Expect = 2e-22 Identities = 80/263 (30%), Positives = 127/263 (48%), Gaps = 21/263 (7%) Query: 57 LIFTKASTRTRVSFQVAMARLGGQTVDLNPQVTQLGRGEPLEDTARVLSRF-CDVMAVRT 115 L F + STRT+VSF +A RL T L + L +GE L+DTA L D + +R Sbjct: 50 LFFAEPSTRTKVSFDMAGKRLSCDTFSLAKSSSSLTKGETLKDTALTLQAMNPDGIVLRH 109 Query: 116 FAQQELLDYAHWASIPVLNALTDLE-HPCQAMADFLTIQEALGSLTGQTLAYVGD--GNN 172 +A A V+NA HP QA+ D T+ + GSL G+T+ +GD + Sbjct: 110 WASGAASFLAERLDCSVINAGDGRHAHPTQALLDGFTLYQEWGSLEGKTVLILGDIAHSR 169 Query: 173 VSHSLMLCGALLGVNVRIGCPQGFEPLPEVIDQARNLAVADARIEVMTDPVDAVRGAQAL 232 V+ S ++ ++G NVR+ P+ P + +N V +V +D +A +G A+ Sbjct: 170 VARSNVIMLTMMGANVRLCGPRTLLP-----NYLKNWPV-----KVYSDINEASKGVDAI 219 Query: 233 YTDVWASMGQEQEQS----QREEAFRGFCLNEDLLAHADPNAIVLHCLPAHRGEEISSGV 288 + + E++Q+ E + F L + A P+ ++H P +RG EISS + Sbjct: 220 ---MCLRLQLERQQAGLLPDTREYSKYFGLGYGQIELAAPDVKIMHPGPVNRGVEISSEL 276 Query: 289 MEGEASRIFDQAENRLHVQQALL 311 + AS I DQ + + + ALL Sbjct: 277 ADSPASLILDQVASGVATRMALL 299 Lambda K H 0.321 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 308 Length adjustment: 27 Effective length of query: 291 Effective length of database: 281 Effective search space: 81771 Effective search space used: 81771 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory