Align Anthranilate synthase component 1 1; EC 4.1.3.27; Anthranilate synthase component I 1 (uncharacterized)
to candidate WP_027721526.1 H589_RS0107910 anthranilate synthase component I family protein
Query= curated2:Q5V448 (489 letters) >NCBI__GCF_000425265.1:WP_027721526.1 Length = 427 Score = 153 bits (387), Expect = 1e-41 Identities = 102/283 (36%), Positives = 145/283 (51%), Gaps = 8/283 (2%) Query: 192 PSVEDPPVETDEATFESDCTRESFADRVQTVKQYIRDGDTFQANVSQRLRA-PAAVHPVE 250 P VE P + + + +ES+ V +YI+DG T+Q N+S + P+ Sbjct: 146 PEVELPDFKPEYISMSLG--KESYEKGVAQTLEYIKDGLTYQLNLSTQFTINDINFDPLL 203 Query: 251 AFDALRTVNPAPYSALLEFPGVDLVSASPELLLHRDGDRIETEPIAGTRPRGETPDADDR 310 F L PAPY AL + G ++S SPEL L + + +EPI GT E D Sbjct: 204 WFFTLNKRYPAPYYALFKSCGKLIISTSPELFLKVENGCVRSEPIKGTLRFDEY---SDD 260 Query: 311 LETDLLDDEKERAEHAMLVDLERNDLGKVSKFGSVEVSDYRRVDRYSEVMHLVSVVEGRL 370 L L KE +E +M+VDL RND+ + K+GSV V ++ V ++ + SVV G L Sbjct: 261 LIKQLTSSAKEDSELSMIVDLVRNDISRECKYGSVTVEKHKSVFAVDNLLQMYSVVHGEL 320 Query: 371 RDGASLQDAIAAVFPGGTITGAPKPRTMEIIDEVEATRRGPYTGSIGLFGFDGRATLNIV 430 DG D + FPGG+ITG PK +ME+ID +E RGP+ GSI + +I Sbjct: 321 ADGKDCIDLFLSAFPGGSITGCPKKSSMELIDMLEPHTRGPFCGSIVMIKGPKDLVSSIA 380 Query: 431 IRTLVRYAEEYHLR--VGAGVVHDSDPDREYQETLDKGRALVN 471 IRT V E L G+G+V DSDP E+ ET+ K +++ Sbjct: 381 IRTAVYDESENKLTYWAGSGIVIDSDPREEFLETMAKAGKIID 423 Lambda K H 0.317 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 489 Length of database: 427 Length adjustment: 33 Effective length of query: 456 Effective length of database: 394 Effective search space: 179664 Effective search space used: 179664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory