Align Aminodeoxychorismate/anthranilate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85; EC 4.1.3.27 (characterized)
to candidate WP_027721527.1 H589_RS0107915 type 1 glutamine amidotransferase
Query= SwissProt::P28819 (194 letters) >NCBI__GCF_000425265.1:WP_027721527.1 Length = 186 Score = 89.4 bits (220), Expect = 4e-23 Identities = 71/179 (39%), Positives = 92/179 (51%), Gaps = 20/179 (11%) Query: 2 ILMIDNYDSFTYNLVQYLGE--LGEELVVKRNDSITIDEIE--ELSP-DFLMISPGP-CS 55 IL+IDN DSFT NL+ + E++ K D I + + EL+ D L+ISPGP C Sbjct: 3 ILIIDNNDSFTNNLMHLFAKEISSVEILSKSCDHILSQDFQSSELNGYDLLIISPGPGCP 62 Query: 56 PDEAGISLEAIKHFAGKIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKTSDIEHDGKTIF 115 D G IK +GK P+ GVCLG Q I + GG R + HG+T I F Sbjct: 63 ADYPGYEA-VIK--SGK-PVLGVCLGMQIINEYCGGKTSRLKGCFHGRTEKIS------F 112 Query: 116 EGLKNPLVATRYHSLIVKPETLPSCFTVTAQTKEGEIMAIRHNDLPIEGVQFHPESIMT 174 GL+ L RYHSL + V ++ EG MA+ H LP+ G QFHPES +T Sbjct: 113 AGLQ--LNVARYHSLFCSE--IGDGLEVISENNEGIPMAVSHGSLPLLGYQFHPESFLT 167 Lambda K H 0.320 0.139 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 103 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 194 Length of database: 186 Length adjustment: 20 Effective length of query: 174 Effective length of database: 166 Effective search space: 28884 Effective search space used: 28884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory