Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate WP_027722435.1 H589_RS0113085 aspartate aminotransferase family protein
Query= SwissProt::Q88FI7 (416 letters) >NCBI__GCF_000425265.1:WP_027722435.1 Length = 398 Score = 174 bits (441), Expect = 4e-48 Identities = 132/412 (32%), Positives = 195/412 (47%), Gaps = 48/412 (11%) Query: 14 HPITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAP 73 +P++++ + + +WD DGK YID + GI V+N+GHC +VE + QA +L + Sbjct: 22 YPVSVARAKGSRLWDIDGKEYIDLLSGISVVNIGHCREDLVEVMTEQARKLVQVS----- 76 Query: 74 HGPYLALMEQLSQFVPVSYPLAG----MLTNSGAEAAENALKVARG------ATGKRAII 123 L E+ + G NSGAEA E A+K+AR II Sbjct: 77 ---NLFYQEEQVECAEKLLTTCGADRVFFCNSGAEANEAAIKLARRYMRTIKERDAYEII 133 Query: 124 AFDGGFHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFS 183 +G FHGRTLATL G+ P K LP ++P TG +ALKA Sbjct: 134 TLEGSFHGRTLATLTATGQAGPIKDGFAPLPEGFKYVP-----TGDI--EALKAA----- 181 Query: 184 VELAVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRF 243 + AA + E VQGEGG L + +A+ E IL+I+DE+QSG RTG+ + Sbjct: 182 ---ITDKTAAIMIEMVQGEGGIKPLPAEYVKAIENLVAENDILLIVDEVQSGLCRTGKWW 238 Query: 244 AFPRLGIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASL 303 A G+ P + AK++A G+P+GA++ + + G T+ G + + L Sbjct: 239 AHQHYGVTPHIFTSAKALANGLPMGAMLATEAIAKGFTPGSHATTFGGGALVAKVSSKVL 298 Query: 304 AQMTDENLATWGERQEQAIVSRYERWKASGLSP-YIGRLTGVGAMRGIEFANADGSPAPA 362 MT+E +A ++ E K P I + G+G M G+E + DGS Sbjct: 299 DIMTEEKIADRAAEMGDFFIT--EALKIQKKFPEKINSVRGLGLMLGVEL-SFDGSEVFT 355 Query: 363 QLAKVMEAARARGLLL-MPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCLA 413 QL R +G +L + GK I+RLL LTI+ + LE L LE+ L+ Sbjct: 356 QL-------RDKGFILNLTKGK---ILRLLPALTIDKKDLETFLKTLEELLS 397 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 398 Length adjustment: 31 Effective length of query: 385 Effective length of database: 367 Effective search space: 141295 Effective search space used: 141295 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory