Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_027722492.1 H589_RS0113385 glutamate--pyruvate aminotransferase
Query= BRENDA::Q8YTF2 (403 letters) >NCBI__GCF_000425265.1:WP_027722492.1 Length = 391 Score = 352 bits (903), Expect = e-101 Identities = 172/380 (45%), Positives = 241/380 (63%), Gaps = 3/380 (0%) Query: 11 RIQQLPPYVFARLDELKAKAREQGIDLIDLGMGNPDGATPQPVVDAAIQALQDPKNHGYP 70 R+ +LPPYVFA+++ELK + R G D+IDLGMGNPD TPQ +VD ++A P NH Y Sbjct: 6 RVHRLPPYVFAKVNELKMQMRHDGEDIIDLGMGNPDIPTPQHIVDKLVEAANKPANHRYS 65 Query: 71 PFEGTASFRRAITNWYNRRYGVVLDPDSEALPLLGSKEGLSHLAIAYVNPGDVVLVPSPA 130 G RR + WY RRYGV LD D E + +G+KEGL+HLA+ ++PGDVV P P+ Sbjct: 66 ASRGIKGLRREMALWYERRYGVELDYDQEVVVTMGAKEGLAHLALVMLSPGDVVFAPDPS 125 Query: 131 YPAHFRGPVIAGGTVHSLILKPENDWLIDLTAIPEEVARKAKILYFNYPSNPTGATAPRE 190 YP H +IAG V + + + D+ DL + + K+L NYP NPTG TA Sbjct: 126 YPIHPYASIIAGADVRRVPIGADRDFFEDLELAMRQTWPRPKLLIINYPHNPTGVTADIP 185 Query: 191 FFEEIVAFARKYEILLVHDLCYAELAFDGYQPTSLLEIPGAKDIGVEFHTLSKTYNMAGW 250 FFE+IV FA++ +L++HDL YA+ FDGY+ S L+ GAKD+GVEF +LSK+Y+M GW Sbjct: 186 FFEKIVDFAKENNLLVIHDLAYADFTFDGYEAPSFLQAKGAKDVGVEFFSLSKSYSMPGW 245 Query: 251 RVGFVVGNRHVIQGLRTLKTNLDYGIFAALQTAAETALQLPDIYLHEVQQRYRTRRDFLI 310 RVGF GNR ++Q L +K+ LDYG+F +Q AA AL P + E+ Y+ RRD L Sbjct: 246 RVGFCCGNREMVQALTRIKSYLDYGLFQPIQIAACAALSGPQDCVREIMNTYQDRRDALC 305 Query: 311 QGLGELGWDVPKTKATMYLWVKCP---VGMGSTDFALNLLQQTGVVVTPGNAFGVAGEGY 367 +GL +GW V KAT ++W + P +GS +F+ LL++ V V PG FG G+ + Sbjct: 306 EGLQRIGWPVTPPKATQFIWAEIPEQFKHLGSVEFSKLLLRECKVAVAPGLGFGSYGDSH 365 Query: 368 VRISLIADCDRLGEALDRIK 387 VR++L+ + R+ +A+ +K Sbjct: 366 VRMALVENRQRINQAVRGMK 385 Lambda K H 0.321 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 391 Length adjustment: 31 Effective length of query: 372 Effective length of database: 360 Effective search space: 133920 Effective search space used: 133920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory