Align N-acetyl-gamma-glutamyl-phosphate reductase; Short=AGPR; EC 1.2.1.38 (characterized, see rationale)
to candidate WP_028310458.1 H566_RS0104200 N-acetyl-gamma-glutamyl-phosphate reductase
Query= uniprot:E4PLW0 (388 letters) >NCBI__GCF_000482785.1:WP_028310458.1 Length = 348 Score = 424 bits (1090), Expect = e-123 Identities = 217/348 (62%), Positives = 260/348 (74%), Gaps = 3/348 (0%) Query: 44 VIKVGIVGGTGYTGVELLRILAVHPEVSVSCITSRSEAGMPVAEMYPNLRGHYDLAFSEP 103 +IKVGIVGGTGYTGVELLR+LA HP+V + ITSR EAGMPVA+M+P+LRG D+AFS P Sbjct: 1 MIKVGIVGGTGYTGVELLRLLAQHPQVQLQAITSRKEAGMPVADMFPSLRGRVDIAFSAP 60 Query: 104 DVNVLGACDLVFFATPHGVAMRMVPELMSAGVRVVDLSADFRLKDLDVWANWYGMAHESP 163 D LGACD+VFFATPHGVAM P L+ AGV+V+DL+ADFRL+D V+ WYGM H + Sbjct: 61 DAATLGACDVVFFATPHGVAMEQGPALLEAGVKVIDLAADFRLRDPVVFEKWYGMPHSAL 120 Query: 164 EWAEKAVYGLPEVVRDEIRNAQLVANPGCYPTAVQLGFLPLLEQG--LVDPKRLIADAKS 221 +KAVYGLPEV RD IR+A+L+ PGCYPT+VQLGFLP+L G LVD LIAD KS Sbjct: 121 ALLDKAVYGLPEVNRDRIRDARLIGLPGCYPTSVQLGFLPVLRDGAKLVDGTTLIADCKS 180 Query: 222 GASGAGRQGKIGMLHGEIGESFKAYGASGHRHLPEIRQGLCGAAGGD-VGVTFVPHLIPM 280 G SGAGR+ ++ L E ++FKAYG GHRHLPEI QGL AG D + +TFVPHL+PM Sbjct: 181 GVSGAGRKAEVHTLLAEASDNFKAYGVKGHRHLPEIEQGLRAIAGHDAINLTFVPHLVPM 240 Query: 281 IRGIEATLYAELKNPADFDRLQALFEQRFDDEPFVDVMPFGSHPETRSVRGANQCRMALH 340 IRGI +TLYA + A QALFE + +EPFVDVMP GSHPETRSVR AN R+A+H Sbjct: 241 IRGIHSTLYARILPEARETDFQALFEAAYANEPFVDVMPAGSHPETRSVRSANTVRIAVH 300 Query: 341 RQEQSNIVIVSSVIDNLVKGAAGQAVQNMNIMFGLKETMGLEAPALLP 388 R + ++V V DNLVKGA+GQ VQ MN+MFGL E+ GL +LP Sbjct: 301 RPGGGDQLVVLVVEDNLVKGASGQGVQCMNLMFGLPESTGLTMLPVLP 348 Lambda K H 0.321 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 444 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 348 Length adjustment: 30 Effective length of query: 358 Effective length of database: 318 Effective search space: 113844 Effective search space used: 113844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_028310458.1 H566_RS0104200 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.8404.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-127 409.6 0.0 6.3e-127 409.4 0.0 1.0 1 lcl|NCBI__GCF_000482785.1:WP_028310458.1 H566_RS0104200 N-acetyl-gamma-gl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000482785.1:WP_028310458.1 H566_RS0104200 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 409.4 0.0 6.3e-127 6.3e-127 1 345 [] 2 348 .] 2 348 .] 0.97 Alignments for each domain: == domain 1 score: 409.4 bits; conditional E-value: 6.3e-127 TIGR01850 1 ikvaivGasGYtGaeLlrllakHpevevtklvssreagkklsevhphlkglvdlkleeleeeeileead 69 ikv+ivG++GYtG+eLlrlla+Hp+v++++++s++eag ++++++p+l+g vd +++ ++++ l ++d lcl|NCBI__GCF_000482785.1:WP_028310458.1 2 IKVGIVGGTGYTGVELLRLLAQHPQVQLQAITSRKEAGMPVADMFPSLRGRVDIAFSAPDAAT-LGACD 69 69***************************8888888*********************988875.679** PP TIGR01850 70 vvflAlphgvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnreei 138 vvf+A+phgv++e p+lle+gvkvidl+adfRl+d+ v+ekwYg++h++ +ll++avYGlpE+nr++i lcl|NCBI__GCF_000482785.1:WP_028310458.1 70 VVFFATPHGVAMEQGPALLEAGVKVIDLAADFRLRDPVVFEKWYGMPHSALALLDKAVYGLPEVNRDRI 138 ********************************************************************* PP TIGR01850 139 kkaklianPGCyaTaalLalaPllk..ekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkv 205 ++a+li+ PGCy+T+++L+ P+l+ +kl++ +++i d+ksGvSgAGrka+ ++l+ae+++n+k+Y v lcl|NCBI__GCF_000482785.1:WP_028310458.1 139 RDARLIGLPGCYPTSVQLGFLPVLRdgAKLVDGTTLIADCKSGVSGAGRKAEVHTLLAEASDNFKAYGV 207 ************************83347899999********************************** PP TIGR01850 206 tkHrHtpEieqelsklaek.kvkvsftphlvpmtrGilatiyaklkkelteeelrklyeevYedepfvr 273 ++HrH pEieq l+++a++ ++++f+phlvpm+rGi++t+ya++ e +e++ ++l+e++Y++epfv+ lcl|NCBI__GCF_000482785.1:WP_028310458.1 208 KGHRHLPEIEQGLRAIAGHdAINLTFVPHLVPMIRGIHSTLYARILPEARETDFQALFEAAYANEPFVD 276 *****************995666********************************************** PP TIGR01850 274 vlkegelPstkavlgsnfvdigvavdeetkrvvvvsaiDNLvKGaagqAvqnlNlmlgfdetegLeklp 342 v+++g+ P+t++v+ n+v+i+v+ +++vv+ + DNLvKGa+gq vq++Nlm+g++e++gL++lp lcl|NCBI__GCF_000482785.1:WP_028310458.1 277 VMPAGSHPETRSVRSANTVRIAVHRPGGGDQLVVLVVEDNLVKGASGQGVQCMNLMFGLPESTGLTMLP 345 ********************************************************************* PP TIGR01850 343 llp 345 +lp lcl|NCBI__GCF_000482785.1:WP_028310458.1 346 VLP 348 988 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (348 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.81 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory