Align Phosphoserine aminotransferase, chloroplastic; PSAT; Phosphohydroxythreonine aminotransferase; EC 2.6.1.52 (characterized)
to candidate WP_028311002.1 H566_RS0107805 3-phosphoserine/phosphohydroxythreonine transaminase
Query= SwissProt::P52877 (430 letters) >NCBI__GCF_000482785.1:WP_028311002.1 Length = 366 Score = 382 bits (980), Expect = e-110 Identities = 202/367 (55%), Positives = 259/367 (70%), Gaps = 9/367 (2%) Query: 68 RVFNFAAGPAVLPENVLQKAQSELLNWRGSGMSVMEMSHRGKEFTSIIDKAEADLRTLLN 127 R FNFAAGPA LP VLQ+AQ+E+L W+G+G SVME+SHRGK+F + +AE DLR LL Sbjct: 3 RAFNFAAGPATLPLEVLQQAQAEMLEWQGTGCSVMEVSHRGKQFEACNAEAEQDLRDLLA 62 Query: 128 IPSDYTVLFLQGGASTQFSAIPLNLCTPDSAVDYIVTGSWGDKAAKEAAKY-----AAVS 182 IPS+Y VLFLQGGAS Q++ NLC + DYI+TG W ++A EA K +V+ Sbjct: 63 IPSNYKVLFLQGGASMQWAQFLFNLCGSNPNGDYILTGEWTNRAVAEARKLLPLWGGSVN 122 Query: 183 SIWSGKSDNYVRIPNFDGSEFVQNSQARYLHICANETIYGVEFKKYPVPANPDGFLVADM 242 + S + NY IP D + + A +LHIC+NETI G+E+ P D LVADM Sbjct: 123 IVASSEDRNYSYIP--DEGSWKRRKDANFLHICSNETIQGLEYNFIPEQLG-DVTLVADM 179 Query: 243 SSNFCSKPVDVTKFGLIYAGAQKNVGPSGVTIVIVRNDLIGNAQKMTPVMLDYKIHADNK 302 SS+ S+PVDV+++GLIYAGAQKN+GP+G+TIVIVR+DLIG A+ TP M DYK+ ADN Sbjct: 180 SSHIVSRPVDVSRYGLIYAGAQKNIGPAGITIVIVRDDLIGKARPDTPRMFDYKLMADNH 239 Query: 303 SLYNTPPCYGIYMCGLVFEDLLNQGGLVEVEKKNKAKAQVLYDAIDESNGFYKCPVEKSV 362 SL NTPP +GIY+ GLVF+ L QGG+ +E+KN AKA++LY +D S FY PVEK Sbjct: 240 SLLNTPPTFGIYLAGLVFKWLKRQGGVEAIERKNIAKAELLYGYLD-SQDFYYAPVEKGS 298 Query: 363 RSLMNVPFTLEKSELEGDFIKEAAKEKMVALKGHRSVGGMRASIYNAMPLAGVEKLVAFM 422 RS MNVPF L+ L F+ E +VALKGH++VGGMRASIYNAMP+ GV+ LVAFM Sbjct: 299 RSRMNVPFRLKDESLNAKFLAETEAAGLVALKGHKAVGGMRASIYNAMPMEGVQALVAFM 358 Query: 423 KEFQAKH 429 ++F A++ Sbjct: 359 RDFAARN 365 Lambda K H 0.317 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 366 Length adjustment: 31 Effective length of query: 399 Effective length of database: 335 Effective search space: 133665 Effective search space used: 133665 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_028311002.1 H566_RS0107805 (3-phosphoserine/phosphohydroxythreonine transaminase)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.10047.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-159 515.5 0.0 3.6e-159 515.3 0.0 1.0 1 lcl|NCBI__GCF_000482785.1:WP_028311002.1 H566_RS0107805 3-phosphoserine/p Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000482785.1:WP_028311002.1 H566_RS0107805 3-phosphoserine/phosphohydroxythreonine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 515.3 0.0 3.6e-159 3.6e-159 2 357 .. 5 364 .. 4 365 .. 0.98 Alignments for each domain: == domain 1 score: 515.3 bits; conditional E-value: 3.6e-159 TIGR01364 2 vnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlflq 70 +nF+aGPa+lp evl++aq+e+l+++g+g+svme+sHR k+fe+ eae+dlr+Ll ip+ny+vlflq lcl|NCBI__GCF_000482785.1:WP_028311002.1 5 FNFAAGPATLPLEVLQQAQAEMLEWQGTGCSVMEVSHRGKQFEACNAEAEQDLRDLLAIPSNYKVLFLQ 73 8******************************************************************** PP TIGR01364 71 GGattqfaavplnllkekkvadyivtGawskkalkeakkltk....evkvvaseeekkyskipdeeele 135 GGa+ q+a+ +nl+ ++ + dyi tG+w+++a++ea+kl +v++vas+e+++ys ipde +++ lcl|NCBI__GCF_000482785.1:WP_028311002.1 74 GGASMQWAQFLFNLCGSNPNGDYILTGEWTNRAVAEARKLLPlwggSVNIVASSEDRNYSYIPDEGSWK 142 ***************************************98888899********************** PP TIGR01364 136 lkedaayvylcanetieGvefkelpevkk.aplvaDlssdilsrkidvskygliyaGaqKniGpaGvtv 203 ++da+++++c+neti+G+e++ +pe+ ++lvaD+ss+i+sr++dvs+ygliyaGaqKniGpaG+t+ lcl|NCBI__GCF_000482785.1:WP_028311002.1 143 RRKDANFLHICSNETIQGLEYNFIPEQLGdVTLVADMSSHIVSRPVDVSRYGLIYAGAQKNIGPAGITI 211 *************************87655*************************************** PP TIGR01364 204 vivrkdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGGvkklekknqeKakll 272 vivr+dl+++a+ ++p ++dYk +a+n+sl+ntpptf+iy++glv+kwlk++GGv+++e+kn +Ka+ll lcl|NCBI__GCF_000482785.1:WP_028311002.1 212 VIVRDDLIGKARPDTPRMFDYKLMADNHSLLNTPPTFGIYLAGLVFKWLKRQGGVEAIERKNIAKAELL 280 ********************************************************************* PP TIGR01364 273 YeaidesegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhrsvGGiRasiYnalpl 341 Y ++d++ +fy ++vek +Rs+mnv+F+lk+e l+++Fl+e+e++glv+lkGh++vGG+RasiYna+p+ lcl|NCBI__GCF_000482785.1:WP_028311002.1 281 YGYLDSQ-DFYYAPVEKGSRSRMNVPFRLKDESLNAKFLAETEAAGLVALKGHKAVGGMRASIYNAMPM 348 *****55.6************************************************************ PP TIGR01364 342 eevqaLvdfmkeFekk 357 e+vqaLv+fm++F+++ lcl|NCBI__GCF_000482785.1:WP_028311002.1 349 EGVQALVAFMRDFAAR 364 *************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (366 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 12.21 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory