Align prephenate dehydrogenase (EC 1.3.1.12); prephenate dehydratase (EC 4.2.1.51); chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_028311003.1 H566_RS0107810 prephenate dehydratase
Query= BRENDA::O30012 (620 letters) >NCBI__GCF_000482785.1:WP_028311003.1 Length = 369 Score = 158 bits (399), Expect = 4e-43 Identities = 107/359 (29%), Positives = 183/359 (50%), Gaps = 20/359 (5%) Query: 266 IEELRGLIKSIDSLILRLIERRIDAARQIARIKMERGEPIELKDVEEEKLWEVMSKTT-- 323 ++ LR I ++D I++L+ R A ++ +K P + E E L ++++ Sbjct: 15 LKPLRDRIDTLDQTIIQLLNERAGVAMEVGEVKKRYHAPAFRPEREAEVLRKIVAGNPGP 74 Query: 324 LNPVKLKEIFEGIMSLAKEEEYKVAGVKYTIAVLGPQGSFSEEMALKLVGSRVPLRYCST 383 L L I+ IMS + E +A LGP G+FSE A G V + C++ Sbjct: 75 LRGDSLHFIYREIMSACRALENTTR-----VAFLGPVGTFSEAAAFAAFGKSVEGQPCAS 129 Query: 384 TDEIIKLVESGEVDYGLVPIENSVNGTVLPVIDALLNHDVEVFGEAKLEVNHCLVAKRKI 443 DE+ + E+G D+G+VP+ENS G V +D LL+ + + GE ++ V+H L+ R Sbjct: 130 IDEVFRATEAGTADFGVVPVENSTEGVVNRTLDLLLHTPLRISGEVEIPVHHNLMT-RSG 188 Query: 444 ELKEIKTIYSHPQAVAQCMGFINNYLPSVAIRYTTSTSDAARMLDDYS--AAIMSENAAR 501 + + I +H QA+AQC +++ + P + S ++AARM D + A + S AA Sbjct: 189 NMDGVTRICAHAQALAQCATWLSTHYPEIERTPVASNAEAARMARDDATVAGVASAAAAT 248 Query: 502 FYRLHVLRKGIQDLKGRNITRFYLIRRRSGRSEGK-ITSLFFGVEDKPGALKDVLEVFHK 560 + +H++ + IQD N TRF +I G+ TSL + PGA+ +LE + Sbjct: 249 NFGVHIVARNIQD-DPHNSTRFAVIGTLDTAPSGRDQTSLVVSTPNVPGAVHKLLEPLAR 307 Query: 561 KGFNLRKLESRP----AGTGLGDYVFFVEVEAPLREED----LLDLKQVTTFYKVVGVF 611 ++ + ESRP GTG+ Y F++++E R+ L +L+++ F+KV+G + Sbjct: 308 NEVSMTRFESRPNRTRVGTGVWTYYFYIDIEGHQRDPKVAAALAELRELCAFFKVLGSY 366 Lambda K H 0.320 0.137 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 396 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 620 Length of database: 369 Length adjustment: 33 Effective length of query: 587 Effective length of database: 336 Effective search space: 197232 Effective search space used: 197232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory