Align Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 (characterized)
to candidate WP_028313608.1 G491_RS0103640 aspartate-semialdehyde dehydrogenase
Query= SwissProt::Q51344 (370 letters) >NCBI__GCF_000429905.1:WP_028313608.1 Length = 373 Score = 488 bits (1256), Expect = e-142 Identities = 237/371 (63%), Positives = 296/371 (79%), Gaps = 3/371 (0%) Query: 1 MKRVGLIGWRGMVGSVLMQRMLEERDFDL--IEPVFFTTSNVGGQGPEVGKDIAPLKDAY 58 M +V +GWRGMVGSVLM RM E DF ++P+FFTTS G + P+VG + L+DA Sbjct: 1 MAKVAFVGWRGMVGSVLMDRMRAEGDFKTTGLDPLFFTTSQTGQKAPDVGLGESLLQDAM 60 Query: 59 SIDELKTLDVILTCQGGDYTSEVFPKLREAGWQGYWIDAASSLRMEDDAVIVLDPVNRKV 118 D+L +D+I+TCQG YT E+ PKLR GW GYWIDAAS++RM+DD+VIVLDPVNR V Sbjct: 61 DADKLLPMDIIVTCQGSGYTKEMHPKLRSMGWDGYWIDAASAMRMDDDSVIVLDPVNRPV 120 Query: 119 IDQALDAGTRNYIGGNCTVSLMLMALGGLFDAGLVEWMSAMTYQAASGAGAQNMRELLKQ 178 ID+AL +G + YIGGNCTVSLMLMALGGLF+ GLVEWM++MTYQAASGAGA+NMREL+ Q Sbjct: 121 IDKALASGVKKYIGGNCTVSLMLMALGGLFENGLVEWMTSMTYQAASGAGAKNMRELIAQ 180 Query: 179 MGAAHASVADDLANPASAILDIDRKVAETLRSEAFPTEHFGAPLGGSLIPWIDKELPNGQ 238 M + + L +PASAI D+DR V ET+RS FPT++FG PL GS+IPWID ELP+GQ Sbjct: 181 MASISGASKALLDDPASAIQDLDRTVLETMRSGDFPTDNFGVPLAGSVIPWIDSELPSGQ 240 Query: 239 SREEWKAQAETNKILARFKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIEGLISQ 298 SREEWK ETNKIL K IP+DG+CVR+G+MRCHSQALTIKL KDVP+ +IE ++++ Sbjct: 241 SREEWKGLVETNKILGTEKQ-IPIDGLCVRIGSMRCHSQALTIKLTKDVPVDEIEDMLAK 299 Query: 299 HNPWVKLVPNHREVSVRELTPAAVTGTLSVPVGRLRKLNMGSQYLGAFTVGDQLLWGAAE 358 N WV+++PN++ S++ L+P AVTG L VPVGR+ KLNMG +YLGAFTVGDQLLWGAAE Sbjct: 300 ANDWVRVIPNNKADSMKLLSPTAVTGGLEVPVGRIHKLNMGPEYLGAFTVGDQLLWGAAE 359 Query: 359 PLRRMLRILLE 369 PLRR+L+I+L+ Sbjct: 360 PLRRILQIILD 370 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 373 Length adjustment: 30 Effective length of query: 340 Effective length of database: 343 Effective search space: 116620 Effective search space used: 116620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_028313608.1 G491_RS0103640 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01745 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01745.hmm # target sequence database: /tmp/gapView.16975.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01745 [M=366] Accession: TIGR01745 Description: asd_gamma: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-177 575.0 0.1 3.5e-177 574.8 0.1 1.0 1 lcl|NCBI__GCF_000429905.1:WP_028313608.1 G491_RS0103640 aspartate-semiald Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429905.1:WP_028313608.1 G491_RS0103640 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 574.8 0.1 3.5e-177 3.5e-177 2 365 .. 3 368 .. 2 369 .. 0.99 Alignments for each domain: == domain 1 score: 574.8 bits; conditional E-value: 3.5e-177 TIGR01745 2 kvglvgwrgmvgsvllkrmqeekdfda..ikpvffstsqlgqkapslakisailedaydidalkeldii 68 kv +vgwrgmvgsvl++rm+ e df++ ++p+ff+tsq gqkap ++ ++ l+da+d d l +dii lcl|NCBI__GCF_000429905.1:WP_028313608.1 3 KVAFVGWRGMVGSVLMDRMRAEGDFKTtgLDPLFFTTSQTGQKAPDVGLGESLLQDAMDADKLLPMDII 71 799**********************864479************************************** PP TIGR01745 69 itcqggdytkeiypklrkagwkgywidaasslrmkddaviildpvnldvikdavnkgirtfvggnctvs 137 +tcqg ytke++pklr gw+gywidaas++rm+dd+vi+ldpvn vi+ a++ g+++++ggnctvs lcl|NCBI__GCF_000429905.1:WP_028313608.1 72 VTCQGSGYTKEMHPKLRSMGWDGYWIDAASAMRMDDDSVIVLDPVNRPVIDKALASGVKKYIGGNCTVS 140 ********************************************************************* PP TIGR01745 138 lllmslgglfrdelvewvsvatyqaasgggarhmrellkqmgvlykeveeelakpssaileierkvtkl 206 l+lm+lgglf+++lvew++++tyqaasg+ga+ mrel+ qm + + + l p+sai +++r v ++ lcl|NCBI__GCF_000429905.1:WP_028313608.1 141 LMLMALGGLFENGLVEWMTSMTYQAASGAGAKNMRELIAQMASISGASKALLDDPASAIQDLDRTVLET 209 ********************************************************************* PP TIGR01745 207 srseelpvenfsvplagslipwidkqldngqsreewkgqaetnkilgtkdtilvdglcvrigalrchsq 275 +rs+++p++nf+vplags+ipwid +l gqsreewkg etnkilgt++ i++dglcvrig++rchsq lcl|NCBI__GCF_000429905.1:WP_028313608.1 210 MRSGDFPTDNFGVPLAGSVIPWIDSELPSGQSREEWKGLVETNKILGTEKQIPIDGLCVRIGSMRCHSQ 278 ********************************************************************* PP TIGR01745 276 altiklkkdvsleeieeiirahnkwvkvvpnereitlreltpaavtgtldipvgrlrklnmgkeylsaf 344 altikl kdv+++eie+++++ n+wv+v+pn++ ++++ l+p+avtg+l++pvgr+ klnmg+eyl af lcl|NCBI__GCF_000429905.1:WP_028313608.1 279 ALTIKLTKDVPVDEIEDMLAKANDWVRVIPNNKADSMKLLSPTAVTGGLEVPVGRIHKLNMGPEYLGAF 347 ********************************************************************* PP TIGR01745 345 tvgdqllwgaaeplrrmlril 365 tvgdqllwgaaeplrr+l+i+ lcl|NCBI__GCF_000429905.1:WP_028313608.1 348 TVGDQLLWGAAEPLRRILQII 368 ******************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (366 nodes) Target sequences: 1 (373 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 12.33 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory